Молекулярное свидетельство эволюции: Урок 2. доказательства эволюции — Биология — 11 класс

Содержание

Молекулярные доказательства эволюции [Молекулярно-биологические, Молекулярно-генетические, Биохимические]

Эволюция белков

Поскольку каждая за­мена аминокислот в молекуле белка связана с изменением одного, двух или трёх нуклеотидов в молекуле ДНК, с помощью компьютеров можно вычислить максимальное или минимальное число нуклеотидных замен в составе гена, участвующего в синтезе данной молекулы белка.

На основе полученных данных можно судить о среднем числе замещений аминокислот в молекуле белка и изменениях в расположении нуклеотидов в составе гена. Как известно, гемоглобин входит в состав красных кровяных телец — эритроцитов и активно участвует в транспорте кислорода. Гемоглобин в эритроцитах человека состоит из взаимно схожих двух α- и двух β-цепей. В каждую цепь α входит 141, в каждую цепь β — 145 аминокислот. Несмотря на взаимные различия α- и β-цепей гемоглобина, последовательность расположения аминокислот в них одинакова. Это свидетельствует о том, что цепи α и β гемоглобина возникли в результате дивергенции единой полипептидной цепи в историческом процессе. В результате мутационных изменений в различных группах животных замещение аминокислот происходило также в α- и β-цепях гемоглобина.

Как видно из данных таблицы 1, молекулы гемоглобина у человека и человекообразных обезьян почти схожи по последовательности аминокислот, однако различия между человеком и другими отрядами млекопитающих животных по этому показателю весьма существенны и составляют от 14 до 33. Такие же данные получены при сопоставлении аминокислотного состава белка цитохрома C человека, дрозофилы и других организмов (таблица 2).

Таблица 1. Различия аминокислотного состава в α- и β-цепях молекулы гемоглобина у человека и других животных (по V. Grant)

Вид

Число различий

α-цепь

β-цепь

Человек — шимпанзе

0

0

Человек — горилла

1

1

Человек — лошадь

18

25

Человек — коза

20—21

28—33

Человек — мышь

16—19

25

Человек — кролик

25

14

Таблица 2. Число различий в аминокислотном составе белка цитохрома C человека и других организмов (по V. Grant)

Вид

Число различий

Человек — макака

1

Человек — лошадь

12

Человек — собака

11

Человек — голубь

12

Человек — змея

14

Человек — лягушка

18

Человек — акула

24

Человек — дрозофила

29

Человек — пшеница

43

Человек — нейроспора

48

Если скорость эволюции белка измеряется числом аминокис­лотных замен в год, то скорость эволюции генов измеряется путём определения нуклеотидных замещений. Однако нуклеотидные заме­ны в составе генов не всегда обусловливают аминокислотную замену в составе белка. Об этом свидетельствует тот факт, что из 20 амино­кислот, входящих в состав белка, 18 кодируются 2, 3, 4 и 6 кодами.

Эволюция ДНК (гена)

Каждый нуклеотид в составе гена может подвергаться мутации. Её называют точечной мутацией. Некоторые нуклеотиды по-разному реагируют на воздействие извне. В некоторых нуклеотидных парах мутация происходит всего один или два раза, у других число мутаций может достигать нескольких сотен. Последние называются «

горячими» точками. Материал с сайта http://wikiwhat.ru

Очень важно и то, какой нуклеотид претерпевает изменения при мутации. Например, фенилаланин обладает кодоном UUU. Если тре­тий нуклеотид этого кодона урацил заменяется аденином или гуани­ном, то положение кодона изменяется и кодоны UUA и UUG вклю­чают в полипептидную цепь не фенилаланин, а лейцин, что приводит к существенному изменению структуры и функции молекулы белка. Обычно у близких друг к другу в систематическом отношении видов число мутаций невелико и, наоборот, у видов, далёких друг от дру­га, — велико. Поэтому, например, ДНК человека оказалась гомоло­гичной ДНК макаки на 66%, быка — на 28%, крысы — на 17%, лосося — на 8%, бактерии кишечной палочки — всего на 2%.

Молекулярные часы эволюции

Обычно, определяя дивергенцию белков у нескольких видов, можно судить о сроках расхождений между ними. Скорость эволюции белка измеряется числом годичных аминокислотных замен в его составе. По аминокислотным заменам в составе белка можно определить момент дивергенции рода, семей­ства, отряда, класса, типа. Например, в результате изучения родос­ловной белка глобина в установлено, что его строение было схожим у общих предков карпа и человека, существовавших около 400 млн лет назад, ехидны и человека — 225 млн лет назад, собаки и чело­века — 70 млн лет назад.

Вопросы к этой статье:
  • Докажите происхождение органического мира от одного предка с точки зрения молекулярной биологии.

  • Как определяется изменение молекулы белка в историческом процессе?

  • Что изменяется быстрей: молекула белка или ген?

  • Расскажите о разновидностях изменений гена.

  • Всегда ли изменение гена обусловливает изменения молекулы белка? Почему?

  • Можно ли определить сроки изменения видов по изменению молекулы белка?

  • Что такое дивергенция?

Проблемы Эволюции

Проблемы Эволюции

 

Предыдущая глава   Следующая глава   Оглавление

Доказательства эволюции

 

6. Молекулярно-генетические и биохимические доказательства

 

Содержание раздела:

Открытия молекулярной генетики блестяще подтвердили факт эволюции

Пример сравнения нуклеотидных и аминокислотных последовательностей

Биохимическое единство жизни

2-я хромосома человека

Эндогенные ретровирусы

Псевдогены

 

Открытия молекулярной генетики блестяще подтвердили факт эволюции

Дарвин опубликовал «Происхождение видов» почти за 100 лет до расшифровки структуры ДНК. Новые знания, полученные с тех пор, могли бы однозначно опровергнуть эволюционное учение, если бы оно было ложно. Вместо этого анализ ДНК дает нам убедительнейшие доказательства теории эволюции. Сам факт наличия наследственной изменчивости необходим для эволюции, и если бы оказалось, что ДНК устойчива к изменениям, это означало бы конец теории. Но ДНК постоянно мутирует, порождая генетическое разнообразие, которое служит материалом для отбора. При этом обычно чем больше генетических различий между организмами, тем сильнее различается и их строение (хотя это не строгое правило, поскольку многие генетические мутации не проявляются в фенотипе). Например, отличия генома человека от генома шимпанзе включают 35 миллионов замен отдельных нуклеотидов, 5 миллионов удалений и вставок, слияние двух хромосом и девять хромосомных инверсий. Это очень небольшая степень различия (порядка 1-2%), учитывая, что размер генома человека и шимпанзе — свыше 3 миллиардов пар нуклеотидов. Все типы мутаций, которые привели к возникновению этих различий, наблюдаются и сегодня у разных организмов как в природе, так и в лаборатории; в противном случае версию об эволюционном происхождении от общего предка пришлось бы пересматривать, то есть это еще один пример фальсифицируемости теории эволюции.

Расшифровка молекулярной основы наследственности (ДНК) и генетического кода на самом деле была важнейшим «моментом истины» в истории эволюционного учения. «Вещество наследственности» вполне могло оказаться разным у разных видов (например, у человека — ДНК, а у шимпанзе — какой-нибудь другой биополимер). Генетический код тоже мог оказаться разным. В обоих случаях эволюционное превращение одного вида в другой, как и их происхождение от общего предка, стало бы принципиально невозможным, и эволюционная теория была бы опровергнута. Но и «вещество наследственности» (полинуклеотиды ДНК и РНК), и генетический код оказались одинаковыми у всех без исключения форм жизни — от вирусов и бактерий до человека включительно. Правда, в генетическом коде изредка встречаются вариации (см.: Генетический код допускает разночтения

), но они очень невелики и обычно затрагивают только некоторые второстепенные, «избыточные» кодоны. Эволюционная теория четко объясняет, почему генетический код практически не может изменяться в ходе эволюции. Чисто «технически» радикальное изменение генетического кода осуществить легко и просто: достаточно внести несколько десятков мутаций в гены транспортных РНК — молекул, играющих ключевую роль в «считывании» кода. В результате, например, «триптофановая» тРНК, распознающая кодон УГГ и присоединяющая к синтезируемой молекуле белка аминокислоту триптофан, начнет распознавать другой кодон или кодоны, например АГГ и АГА, которые сейчас кодируют аргинин. Но в результате этой простой мутации произойдет радикальное изменение всех белков, синтезируемых клетками организма: во всех белковых молекулах там, где должен быть аргинин, окажется триптофан. Такое изменение, затронувшее сразу все белки, не может не оказаться чрезвычайно вредным для организма. Соответственно, такая мутация немедленно будет отсеяна отбором. Антиэволюцинизм, напротив, не может предложить никаких внятных объяснений наблюдаемого единства генетического кода у всех организмов. Творец вполне мог бы снабдить разные виды сотворенных им существ разными генетическими кодами — ну хотя бы для того, чтобы не вводить биологов во искушение, предоставляя им еще один чрезвычайно весомый довод в пользу эволюции. К тому же это было бы и полезно для организмов, так как предотвратило бы межвидовую передачу болезнетворных вирусов. Именно таким путем человек «обзавелся» вирусами оспы (от рогатого скота), СПИДа (от обезьян), гриппа и др. Чисто «технически» разные варианты кода совершенно равнозначны и работать смогли бы одинаково хорошо.

Различия между геномами видов должны соответствовать не только экспериментально наблюдаемым типам мутаций, но и филогенетическому дереву, и палеонтологической летописи. Подобно тому, как анализ ДНК позволяет установить степень родства между двумя людьми, тот же самый анализ ДНК (сравнение отдельных генов или целых геномов) позволяет выяснить степень родства между видами, а зная количество накопленных различий, исследователи определяют время расхождения двух видов, то есть время, когда жил их последний общий предок. Например, согласно данным палеонтологии, общий предок человека и шимпанзе жил примерно 6 миллионов лет назад (такой возраст имеют, например, ископаемые находки оррорина и сахелантропа — форм, морфологически близких к общему предку человека и шимпанзе). Для того, чтобы получилось наблюдаемое число различий между геномами, на каждый миллиард нуклеотидов должно было приходиться в среднем 20 изменений за одно поколение. Сегодня у людей скорость мутаций составляет 10-50 изменений на каждый миллиард нуклеотидов за одно поколение (Giannelli, F., Anagnostopoulos, T., Green, P. M. Mutation rates in humans. II. Sporadic mutation-specific rates and rate of detrimental human mutations inferred from hemophilia B.), то есть данные палеонтологии согласуются с результатами анализа ДНК, в строгом соответствии с теорией эволюции (см. материал Genetic rates of change из архива TalkOrigins.org.)

Для того, чтобы построить филогенетическое дерево, достаточно рассмотреть несколько генов, присутствующих у всех организмов, которые мы хотим включить в это дерево (обычно чем больше генов, тем статистически достовернее получаются элементы дерева — порядок ветвления и длины ветвей).

Особый интерес представляют случаи, когда различия геномов оказываются нейтральными, то есть не влияют на организм. Например, было рассчитано, что цитохром c может быть составлен как минимум 2.3 * 1093 разными способами за счет того, что одинаковую по функции и биологически значимым свойствам молекулу белка можно получить с помощью разных последовательностей аминокислот. В свою очередь, каждая из этих последовательностей может быть закодирована 1046 различными последовательностями ДНК вследствие избыточности генетического кода (разные тройки нуклеотидов кодируют одну и ту же аминокислоту). Нет никаких априорных причин, кроме происхождения от общего предка, по которым два разных вида должны были бы иметь хотя бы отдаленно похожие последовательности ДНК для кодирования нормально работающего (функционального) цитохрома c. То же самое справедливо и для других белков. Тем не менее аминокислотные последовательности большинства белков у близкородственных видов (например, у шимпанзе и человека), как правило, очень похожи. Так, подавляющее большинство гомологичных белков человека и шимпанзе различаются лишь на 1-2 аминокислоты или не различаются вовсе. Различий в нуклеотидных последовательностях обычно больше за счет незначимых, или синонимичных (не влияющих на аминокислотную последовательность белка) нуклеотидных замен.

По соотношению несинонимичных и синонимичных нулеотидных замен (dN/dS) можно определить, насколько сильно действует на данный ген «очищающий» отбор, отбраковывающий мутации, которые меняют свойства белка. Как правило, чем консервативнее (постояннее) функция белка, тем ниже этот показатель. Повышение dN/dS свидетельствует о положительном отборе, т.е. о закреплении полезных  мутаций. Например, повышенное значение dN/dS у человека по сравнению с другими млекопитающими зафиксировано в гене FOXP2, который связан со способностью к произнесению членораздельных звуков (см.: Будут ли расшифрованы генетические основы разума?; «Ген речи» FOXP2 оказался регулятором высокого уровня).

Малое число различий в аминокислотных последовательностях белков у близких видов связано не только с тем, что эти различия еще не успели накопиться, но и с тем, что многие одинаково удачные для выполнения данной функции аминокислотные последовательности (см. выше) отделены друг от друга так называемыми «ямами в ландшафте приспособленности». Это значит, что для того, чтобы перейти от одной такой последовательности к другой, функционально равнозначной, нужно приобрести сразу несколько мутаций, каждая из которых по отдельности может снижать функциональность белка. Многие из этих «ям» можно обойти, последовательно приобретая ряд нейтральных мутаций, но это долгий процесс, основанный на случайностях, а не на позитивном отборе, и поэтому он занимает много времени (см.: The Molecular Sequence Evidence из архива TalkOrigins.org.)

 

Пример сравнения нуклеотидных и аминокислотных последовательностей человека и шимпанзе

Сравнительный анализ нуклеотидных последовательностей позволяет судить о степени родства сравниваемых организмов. Это обстоятельство широко применяется на практике (в частности, для установления отцовства). Например, недавно на основе анализа ДНК из человеческих костей, обнаруженных под Екатеринбургом, удалось доказать, что это останки семьи последнего российского императора Николая II. При этом для сравнения был использован генетический материал ныне живущих родственников царской семьи (см.: Генетический анализ показал, что из детей Николая II не спасся никто).

Изучая семьи с известной генеалогией, генетики оценивают скорость накопления различий в ДНК. В частности, большую помощь оказало исследование ДНК населения Исландии — уникальной страны, где каждый житель знает всех своих предков вплоть то первых колонистов, прибывших в Исландию из Норвегии в IX веке (причем из останков нескольких первопоселенцев тоже удалось извлечь ДНК для анализа). Теми же методами можно реконструировать историю целых народов или, к примеру, находить среди современных азиатов потомков Чингисхана. Результаты генетического анализа при этом хорошо согласуются с сохранившимися историческими сведениями. В ходе многочисленных исследований такого рода, где можно было непосредственно сравнить генетические данные с историческими, генетики раз за разом убеждались в достоверности оценок родства на основе сравнения ДНК, а используемые методы развивались и совершенствовались.

Поэтому сегодня мы имеем возможность при помощи этих многократно проверенных и «откалиброванных» методов оценивать степень родства и таких организмов, по которым у нас нет прямых исторических данных. Результаты таких исследований позволяют устанавливать степень родства различных видов живых организмов с такой же степенью надежности, как и в случае установления отцовства или идентификации останков царской семьи. В частности, наше близкое родство с шимпанзе записано в наших геномах, можно сказать, аршинными буквами.

Рассмотрим пример сравнения нуклеотидных последовательностей ДНК и аминокислотных последовательностей белка у человека и шимпанзе.

 

Аминокислоты M  T  P  T  R  K  I  N  P  L  M  K  L  I  N  H  S  F  I  D
Нуклеотиды   ATGACCCCGACACGCAAAATTAACCCACTAATAAAATTAATTAATCACTCATTTATCGAC  60    шимпанзе
             |||||||| | |||||||| |||||| ||||||||||||||||| |||||||| ||||||
             ATGACCCCAATACGCAAAACTAACCCCCTAATAAAATTAATTAACCACTCATTCATCGAC  60    человек
             M  T  P  M  R  K  T  N  P  L  M  K  L  I  N  H  S  F  I  D
 
             L  P  T  P  S  N  I  S  A  W  W  N  F  G  S  L  L  G  A  C
             CTCCCCACCCCATCCAACATTTCCGCATGATGGAACTTCGGCTCACTTCTCGGCGCCTGC  120
             |||||||||||||||||||| ||||||||||| |||||||||||||| || |||||||||
             CTCCCCACCCCATCCAACATCTCCGCATGATGAAACTTCGGCTCACTCCTTGGCGCCTGC  120
             L  P  T  P  S  N  I  S  A  W  W  N  F  G  S  L  L  G  A  C
 
             L  I  L  Q  I  T  T  G  L  F  L  A  M  H  Y  S  P  D  A  S
             CTAATCCTTCAAATTACCACAGGATTATTCCTAGCTATACACTACTCACCAGACGCCTCA  180
             || ||||| ||||| ||||||||| |||||||||| || |||||||||||||||||||||
             CTGATCCTCCAAATCACCACAGGACTATTCCTAGCCATGCACTACTCACCAGACGCCTCA  180
             L  I  L  Q  I  T  T  G  L  F  L  A  M  H  Y  S  P  D  A  S
 

Здесь показан начальный фрагмент (180 нуклеотидов) митохондриального гена цитохрома b шимпанзе и человека. Митохондриальные гены накапливают мутации примерно в 5-10 раз быстрее, чем ядерные. Поэтому митохондриальные гены человека и шимпанзе различаются на 9%, а ядерные — где-то на 1-2%. Здесь показан митохондриальный ген, потому что если бы мы взяли ядерный ген, сходство было бы очень большим, и нам пришлось бы приводить гораздо более длинную последовательность, чтобы наглядно продемонстрировать характер различий. А вообще ген можно взять практически любой — картина будет качественно одна и та же. 

Из 60 аминокислот, кодируемых этими 180 нуклеотидами, у шимпанзе и человека различаются только две (4-я и 7-я, выделены красным). Из 60 кодонов (триплетов, троек нуклеотидов) различаются 16, однако только 2 из 16 различий являются «значимыми» (несинонимичными), а остальные — синонимичные, не влияющие на структуру белка. Синонимичные нуклеотидные отличия человека от шимпанзе веделены зеленым цветом и подчеркиванием, несинонимичные — красным цветом и подчеркиванием.

Генетическое родство человека и шимпанзе доказывается даже не столько сходством последовательностей, сколько характером различий между ними. Легко заметить, что характер этих различий полностью соответствует предсказаниям эволюционной теории. Больше всего должно быть синонимичных нуклеотидных замен, потому что такие замены не влияют на свойства белка и, следовательно, невидимы для отбора, не отбраковываются им. Именно это мы и наблюдаем.

То, что в большинстве случаев (44 из 58) для кодирования одной и той же аминокислоты в геноме человека и шимпанзе используется один и тот же триплет — это еще одно доказательство генетического родства. С точки зрения функциональности нет абсолютно никакой разницы, каким из нескольких триплетов, соответствующих данной аминокислоте, закодировать ее в каждом конкретном случае. Например, аминокислота T (треонин) кодируется любым из четырех кодонов: ACA, ACT, ACG, ACC. Эта аминокислота встречается в одинаковых позициях в рассматриваемом фрагменте белка человека и шимпанзе четырежды. При этом в каждом из четырех случаев она закодирована у обоих видов одним и тем же кодоном (в первых трех случаях это кодон ACC, в четвертом — ACA). Вероятность случайности такого совпадения 0.254 = 0.0039. Если собрать все такие случаи по геномам человека и шимпанзе, вероятность случайности получится невообразимо ничтожной, практически неотличимой от нуля.

Таким образом, дело здесь не просто в сходстве ДНК, дело в характере сходства, которое выходит далеко за пределы любой функциональной оправданности. Особенно важно сходство по бессмысленным частям генетического «текста» (сюда относится и использование одинаковых синонимичных кодонов), а также по характерным ошибкам в нем (см. ниже об эндогенных ретровирусах и псевдогенах). Для любого специалиста по сравнительной геномике кровное родство человека и шимпанзе абсолютно очевидно и не вызывает даже тени сомнения. Опытный учитель сразу поймет, что один ученик бездумно списал у другого, если заметит в их сочинениях не только одинаковые мысли (это еще можно объяснить одинаковыми намерениями авторов), но и одинаковые фразы, используемые для их выражения, а особенно — одинаковые ошибки и одинаковые сорные словечки в одних и тех же местах текста. Все эти бесспорные признаки единства происхождения (а не независимого сотворения) в величайшем изобилии присутствуют в геномах близкородственных видов, каковыми являются человек и шимпанзе. 

Сравним теперь аминокислотные последовательности того же самого фрагмента цитохрома b у шимпанзе, человека и макаки резуса:

Pan    MTPTRKINPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFLAMHYSPDAS
Homo   MTPMRKTNPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFLAMHYSPDAS
Macaca MTPMRKSNPILKMINRSFIDLPAPPNLSMWWNFGSLLAACLILQIITGLLLAMHYSPDTS

Как видим, у макаки аминокислотная последовательность этого белка сильнее отличается от человеческой и шимпанзиной, чем последовательности первых двух видов друг от друга (14 аминокислотных различий между макакой и шимпанзе, 13 — между макакой и человеком, 2 — между шимпанзе и человеком). Это полностью соответствует биологической систематике и эволюционному дереву (шимпанзе — гораздо более близкий родственник человека, чем макака). То, что по одной аминокислоте (4-й) макака больше похожа на человека, чем на шимпанзе, означает, что, скорее всего, у общего предка макаки и человекообразных в этой позиции стояла аминокислота M, которая сохранилась у макаки и человека. Однако в линии шимпанзе, уже после ее отделения от человеческой линии, произошла замена M на T.

Интересно взглянуть на ситуацию с точки зрения шимпанзе. Для этого вида человек — более близкий родственник, чем любая другая обезьна. Даже горилла, внешне не так уж сильно отличающаяся от шимпанзе (по крайней мере на наш человеческий взгляд), приходится шимпанзе более дальней родственницей, чем человек. В свою очередь, для гориллы люди и шимпанзе — самые близкие родственники, значительно более близкие, чем любые другие обезьяны.

Таким образом, результаты сравнения генов и белков подтверждают представления о родственных связях между видами (эволюционном дереве), которые сложились задолго до «прочтения» геномов. Аналогичные результаты получаются при сравнении практически любых генов в любых группах организмов. Каждый читатель может убедиться в этом самостоятельно, поскольку все прочтенные гены и программное обеспечение для их анализа находятся в свободном доступе.

 

Биохимическое единство жизни

Носителем наследственной информации во всех клетках являются молекулы ДНК, у всех известных организмов в основе размножения — репликация этой молекулы. В ДНК всех организмов используются 4 нуклеотида (аденин, гуанин, тимин, цитозин), хотя в природе встречаются не менее 102 различных нуклеотидов. Кроме того, в природе встречается 390 различных аминокислот, но белки всех организмов составляются из одного и того же набора, в котором всего 20 «основных» аминокислот и пара «дополнительных». При этом возможно 1.4 * 1070 различных информационно эквивалентных генетических кодов, использующих те же самые кодоны и аминокислоты.

Как уже говорилось, если не учитывать эволюционное происхождение всех организмов от общего предка, то ничто не мешает каждому виду иметь собственный генетический код. Такое положение вещей было бы крайне выгодным, так как при этом исключалось бы преодоление вирусами межвидовых барьеров. Тем не менее, ничего подобного не наблюдается, и теория эволюции исключает такую возможность (см. выше).

Ученые, открывшие устройство генетического кода в 50-х и 60-х годах, в своих исследованиях активно использовали предположение, что код практически универсален. Эти ученые (Фрэнсис Крик, Сидней Бреннер, Георгий Гамов и другие) сделали это предположение исходя из версии об эволюционном происхождении от общего предка, не имея никаких прямых доказательств универсальности кода. Полагаясь на универсальность кода, Бреннер в 1957 году пришел к выводу о неперекрываемости кода (один и тот же нуклеотид не может входить одновременно в состав двух или более триплетов) (Brenner, S. (1957) «On the impossibility of all overlapping triplet codes in information transfer from nucleic acid to proteins.»). Работа имела большое значение, так как до нее большинство исследователей считали код перекрывающимся.

В 1961 году, за пять лет до открытия устройства кода, Фрэнсис Крик сослался на работу Бреннера в статье «Общая природа генетического кода для белков». Основываясь на эволюционном предсказании об универсальности кода (в частности — на предположении о том, что у бактерий, табака и людей код устроен одинаково), Крик установил такие важнейшие свойства генетического кода, как триплетность (значащей единицей кода является сочетание трёх нуклеотидов — триплет, или кодон), неперекрываемость и наличие «стартовых» кодонов, с которых начинается чтение информации.

Единство генетического кода широко используется в биотехнологии. Например, бактериям встраивают ген человека, отвечающий за выработку инсулина, и бактерии начинают синтезировать человеческий гормон.

Также можно отметить крайне похожие пути метаболизма в клетках всех организмов. Так, гликолиз у всех эукариот и у большинства прокариот проходит за 10 одинаковых шагов, в одной и той же последовательности, с использованием одних и тех же десяти ферментов (при том что возможны тысячи различных, но термодинамически эквивалентных путей гликолиза). У всех изученных видов основным переносчиком энергии в клетке является аденозинтрифосфат (АТФ), хотя на эту роль могли бы претендовать сотни других молекул (см.: The fundamental unity of life из архива TalkOrigins.org).

 

2-я хромосома человека

После слияния двух хромосом остаются характерные следы: остатки теломер и рудимертарная центромера.

У всех человекообразных обезьян по 24 хромосомы, за исключением людей, у которых лишь 23 хромосомы. Человеческая 2-я хромосома является результатом слияния двух хромосом предков (Alec MacAndrew. Human Chromosome 2 is a fusion of two ancestral chromosomes).

 

Англ. ролик про 2-ую хромосому человека.

(Если ролика не видно на странице, его можно посмотреть здесь)

Доказательства слияния основываются на следующих фактах:

  • Хромосома человека соответствует двум хромосомам обезьян. Ближайший человеческий родственник, бонобо, имеет практически идентичные находящимся 2-й хромосоме человека последовательности ДНК, но они расположены на двух отдельных хромосомах. То же самое верно и для более дальних родственников: гориллы и орангутана (см.: Comparison of the Human and Great Ape Chromosomes as Evidence for Common Ancestry)

  • На хромосоме человека имеются рудиментарные центромеры. Обычно хромосома имеет только одну центромеру, но на длинном плече 2-й хромосомы наблюдаются остатки второй.

  • Кроме того, на хромосоме человека имеются рудиментарные теломеры. Обычно теломеры находятся только на концах хромосомы, но последовательности нуклеотидов, характерные для теломер, наблюдаются ещё и в середине 2-й хромосомы.

2-я хромосома, таким образом, представляет собой убедительное доказательство эволюционного происхождения людей и других обезьян от общего предка.

 

Эндогенные ретровирусы

Эндогенные ретровирусы представляют собой следы древних вирусных инфекций в ДНК. Ретровирусы (такие как ВИЧ и Т-лимфотропный вирус человека, вызывающий лейкоз и лимфому) встраивают собственный геном в геном клеток зараженного организма. Обычно после этого клетка начинает продуцировать новые копии вируса. В этом процессе возможны сбои: копирование встроенной вирусной последовательности подавляется клеткой хозяина. Сама вирусная последовательность остается в структуре хромосомы. Если вирус встроился в геном стволовой половой клетки, то встроенную вирусную последовательность могут унаследовать потомки инфицированной особи. Ретровирусы встраиваются в геном случайным образом, вероятность независимой встройки одинаковых вирусов на одинаковые позиции у двух разных организмов пренебрежимо мала. А значит, встроенный геном одного и того же ретровируса может присутствовать у двух животных на одной и той же позиции в ДНК только в том случае, если эти животные произошли от общего предка.

Около 1 % человеческого генома занимают эндогенные ретровирусы, всего таких последовательностей в ДНК каждого человека около 30000 (Е. Д. Свердлов Retroviruses and primate evolution). Некоторые из этих ретровирусов встречаются только у человека. Другие последовательности встречаются только у шимпанзе и у человека, причем в одних и тех же позициях в геноме (тем самым подтверждается происхождение человека и шимпанзе от одного предка). Также есть последовательности, встречающиеся у горилл, шимпанзе и человека, у орангутанов, горилл, шимпанзе и человека, и так далее (см.: Endogenous retroviruses из архива TalkOrigins.org). Распределение эндогенных ретровирусов в точности соответствует филогенетическому дереву. См. также: Предки человека заимствовали полезные гены у вирусов

Также можно привести пример из семейства кошачьих. У малых кошек (точнее — у таких животных, как камышовый кот, европейская лесная кошка, степная кошка и домашняя кошка) найдена общая ретровирусная вставка. Ни у каких других хищников этот ретроген не обнаружен.

 

Ролик про эндогенных ретровирусов:

(если ролика не видно на странице, его можно посмотреть здесь)

 

 

Антиэволюционистам практически нечего возразить на совершенно убийственный для них «аргумент от эндогенных ретровирусов». Иногда они пытаются утверждать, что эндогенные ретровирусы якобы выполняют полезные функции в геноме многоклеточных организмов, и этим якобы объясняется их присутствие в одних и тех же местах генома у человека и шимпанзе и т.д. Но все эндогенные ретровирусы человека на самом деле неактивны, они давно утратили свою активность в результате мутаций. Другое дело, что в ходе эволюционного процесса, получившего название «молекулярное одомашнивание», некоторые отдельные фрагменты ретровирусных геномов (но не целые геномы) иногда «кооптируются» хозяином для выполнения каких-то полезных функций (см. в заметках: Предки человека заимствовали полезные гены у вирусов; Наездники подавляют иммунную защиту своих жертв при помощи прирученных вирусов). Большинство встроенных ретровирусных геномов, однако, совершенно бесполезны для хозяина, да и «молекулярное одомашнивание» никоим образом не может объяснить факт их присутствия в одних и тех же местах в геномах разных видов.

 

Псевдогены

Псевдогены — это неработающие, «молчащие» гены, которые возникают в результате мутаций, выводящих нормальные «рабочие» гены из строя (существуют и другие, более редкие пути возникновения псевдогенов). Псевдогены представляют собой настоящие «генетические рудименты». Если мутация выведет из строя ген, полезный для организма, она почти наверняка будет отсеяна отбором. Однако некоторые гены, в прошлом полезные, могут стать ненужными, например, из-за смены образа жизни. Мутация, выводящая из строя такой ген, не отсеивается отбором и может закрепиться в популяции. Псевдогены могут долго сохраняться в геноме в качестве ненужного «балласта». Мутации, которые в дальнейшем будут происходить в псевдогене, безразличны для выживания организма, и поэтому такие мутации свободно накапливаются и в конце концов могут изменить псевдоген до неузнаваемости. Однако на это уходит обычно много времени (десятки или даже сотни миллионов лет). Поэтому в геномах большинства организмов, включая человека, псевдогены на той или иной стадии мутационной деградации присутствуют в больших количествах. Псевдогены представляют собой своеобразную «историческую хронику», рассказывающую об образе жизни и адаптациях далеких предков изучаемого организма.

Например, в геноме человека в псевдогены превратились многие гены обонятельных рецепторов. Это и понятно, поскольку обоняние не имело существенного значения для выживания людей в историческое время, и, по-видимому, в доисторическое тоже (подробнее см. в заметке: Обоняние и цветное зрение в эволюции млекопитающих развивались в противофазе).

Ярким доказательством эволюции является присутствие одинаковых псевдогенов в одних и тех же местах генома у видов, произошедших сравнительно недавно от общего предка. Так, у человека есть псевдоген GULO, который представляет собой «сломанный» ген фермента глюконо-лактон-оксидазы. Этот фермент необходим для синтеза аскорбиновой кислоты. У других приматов обнаружен точно такой же псевдоген, причем мутационная «поломка», нарушившая работу гена, у него такая же, как и в человеческом псевдогене. Причины очевидны: в связи с переходом предков современных приматов к питанию растительной пищей, богатой витамином C, данный ген перестал быть необходимым для выживания. Мутация, испортившая ген, не была отсеяна отбором, закрепилась и была унаследована обезьянами и человеком. У других млекопитающих (например, у крысы) GULO является не псевдогеном, а работающим геном, и поэтому крысам не нужно получать витамин C с пищей: они синтезируют его сами. В других группах млекопитающих, которые независимо от приматов перешли к питанию пищей, богатой витамином С, тоже произошла псевдогенизация гена GULO, но мутации, выведшие ген из строя, у них были другие (пример — морские свинки).

Еще один пример: у млекопитающих есть три гена, которые у птиц и рептилий отвечают за производство белка вителлогенина, который входит в состав желтка в яйце. Почти у всех млекопитающих эти три гена — «мертвые», псевдогенизированные. Только яйцекладущие однопроходные звери (утконос, ехидна) синтезируют вителлогенин. У однопроходных из трех генов вителлогенина «мертвы» только два, а третий сохранил функциональность. Между прочим, хотя у плацентарных мелкопитающих желток не образуется, в ходе эмбриогенеза развивается рудиментарный желточный мешок (наполненный жидкостью), присоединенный к кишечнику зародыша. На втором месяце беременности у человека желточный мешок отделяется от эмбриона.


См. также: Ф. Коллинз. «Расшифровка божественных чертежей» (Глава из книги Фрэнсиса Коллинза «Доказательство Бога. Аргументы ученого». 2008). Полный текст книги в формате djvu. Ф.Коллинз — крупный американский генетик, руководитель проекта «Геном человека». В книге «Доказательство Бога» он приводит генетические аргументы в пользу эволюции и обосновывает свою точку зрения о том, что современная эволюционная биология, как и наука в целом, не противоречат христианству.

 

 

Предыдущая глава   Следующая глава   Оглавление

 

 

Рекламные ссылки

Презентация «Молекулярные свидетельства эволюции» (11 класс) по биологии – проект, доклад

Слайд 1

СВИДЕТЕЛЬСТВА ЭВОЛЮЦИИ (Факты, доказывающие эволюционный процесс)

Презентация к уроку биологии в 11 классе (по учебнику «Биология. 11 класс : базовый уровень / под ред. Д.К. Беляева и Г.М. Дымшица. – М. : Просвещение, 2014) Автор: Лысенко И.П., учитель биологии СОШ № 15

Слайд 2

Свидетельства эволюции (факты, доказывающие эволюционный процесс) — научные данные и концепции, подтверждающие эволюцию органического мира на Земле. Различные биологические науки представляют свои свидетельства.

ОСНОВНЫЕ СВИДЕТЕЛЬСТВА ЭВОЛЮЦИИ

Биохимические Генетические Морфологические Эмбриологические

Палеонтологические

Биогеографические

Молекулярные

Слайд 3

МОЛЕКУЛЯРНЫЕ СВИДЕТЕЛЬСТВА ЭВОЛЮЦИИ

Биохимия — … Генетика — … Геном человека

Слайд 4

Единый механизм хранения наследственной информации

Для всех живых организмов существует единый генетический код: три нуклеотида (триплет) кодируют одну аминокислоту.

В 1968 г. американский ученый Маршалл Ниренберг (1927-2010) за расшифровку генетического кода был удостоен Нобелевской премии.

Слайд 5

ДНК Первичные структуры белков клетки Третичные структуры Функции белков Особенности клетки

Транскрипция — … Трансляция — …

Схема синтеза белка в клетке

Единый механизм реализации наследственной информации

Слайд 6

В основе размножения организмов лежит деление клеток.

Митоз — … Мейоз — …

Биологический смысл

из одной диплоидной (2n)

2 диплоидные (2n) клетки

4 гаплоидные (n) клетки

Единый механизм передачи наследственной информации

Слайд 7

«Молекулярные часы эволюции»

Процесс эволюции на молекулярном уровне связан с изменением состава нуклеотидов в ДНК и РНК, а также аминокислот в белках. «Молекулярные часы эволюции» — понятие, введенное американскими исследователями Э.Цукер-Кандлем и Л.Поллингом. Изучая закономерности эволюции белков, исследователи пришли к выводу, что для каждого конкретного типа белков скорость эволюции своя, и она постоянна. (Говоря об эволюции белка, мы подразумеваем соответствующий ген).

Слайд 8

Медленно изменяются, то есть являются консервативными уникальные гены, кодирующие жизненно важные белки (глобин, цитохром – дыхательный фермент и др.).

Некоторые белки вируса гриппа эволюционируют в сотни раз быстрее, чем гемоглобин или цитохром. Благодаря этому к вирусу гриппа не формируется прочный иммунитет.

Сравнение аминокислотной последовательности в белках рибосом, последовательности нуклеотидов рибосомных РНК у разных организмов подтверждает классификацию основных групп организмов.

Слайд 9

ГЕНЕТИЧЕСКАЯ ЛЕТОПИСЬ ЭВОЛЮЦИИ

Чем больше поколений отделяет современные виды от их общего предка, тем больше мутаций.

Геном вида – генетическая летопись эволюции.

Мутация – стойкое изменение генотипа

геномные хромосомные генные

Слайд 10

Различия аминокислотного состава молекул гемоглобина у представителей разных таксонов

Чем дальше разошлись виды, происходящие от общего предка, тем больше у таких видов будут различаться одни и те же белки по аминокислотному составу.

Слайд 11

ФИЛОГЕНЕТИЧЕСКОЕ ДРЕВО

Филогенетическое древо – диаграмма в форме древа, отражающая происхождение видов живых организмов от общего предка. Расшифровка геномов видов животных и растений позволили уточнить филогенетическое древо, построенное на основе морфологических признаков. Так, генетики пересмотрели родину сумчатых. Сравнение не так давно расшифрованных геномов кенгуру и опоссума принесло весьма необычный результат. Германские учёные из Вестфальского университета Вильгельма выяснили, что все сумчатые произошли от предка, который проживал на территории современной Южной Америки.

Слайд 12

Подумайте, что изучает одно из направлений молекулярной биологии -молекулярная филогения. Найдите информацию об изменении филогенетического древа отдельных видов животных и растений на основе молекулярно-генетического анализа.

Умникам и умницам

Подробный план-конспект урока по биологии на тему «Доказательства эволюции» | План-конспект урока по биологии (11 класс) на тему:

11 класс. БИОЛОГИЯ. ОБЩАЯ БИОЛОГИЯ.

ПЛАН-КОНСПЕКТ УРОКА № 3.

Тема: Доказательства эволюции.

Система понятий урока: гомологичные органы, рудиментарные органы, атавизмы, флора, фауна.

Задачи: развить представление о биологической эволюции как объективном процессе исторического развития живой природы, раскрыть сущность эмбриологических, морфологических, палеонтологических, биогеографических и молекулярных доказательств эволюции, развивать умение применять знания о сходстве зародышей позвоночных животных, гомологичных органах, рудиментах, атавизмах, ископаемых переходных формах, специфике островной флоры и фауны для обоснования объективности исторического развития живой природы.

Тип урока: урок-лекция, комбинированный урок.

Методы: частично-поисковый, объяснительно-иллюстративный, мультимедийная презентация слайдов, демонстрация натуральных объектов.

Методические приёмы: рассказ, беседа, демонстрация таблиц, рисунков, слайдов.

Средства наглядности: изобразительные: рельефная таблица «Эмбрионы позвоночных животных», таблицы «Гомологичные органы», «Рудименты человека и животных», слайды; натуральные: коллекция «Формы сохранности живых организмов».

                                                         ХОД УРОКА

I. Организация класса.

Приветствие, сообщение темы урока и плана работы, отметка отсутствующих.

План лекции (на доске):

1. Эмбриологические доказательства эволюции.

2. Морфологические доказательства эволюции.

3. Палеонтологические доказательства эволюции.

4. Биогеографические доказательства эволюции.

5. Молекулярно-биологические доказательства эволюции.

II. Проверка знаний, умений и навыков.

1) Какие наблюдения привели Дарвина к мысли об изменяемости видов?

2) В чём заключается сущность теории Дарвина? Чем она сходна с теорией Ламарка и чем отличается от неё?

3) В чём значение законов Менделя для понимания механизмов эволюции?

III. Изучение нового материала.

Доказывая факт существования эволюционного процесса, учёные используют различные доказательства, которые были получены из достоверных научных данных таких биологических дисциплин как эмбриология, морфология, сравнительная анатомия, систематика, палеонтология, биогеография, молекулярная биология.

Весь органический мир един по химическому составу, клеточному строению (кроме вирусов), по принципиальному сходству процессов жизнедеятельности. Генетическое кодирование, биосинтез белков и нуклеиновых кислот, процессы митоза и мейоза у живых организмов едино. Универсальным источником энергии для всего живого является молекула АТФ. Это всё свидетельствует об общности происхождения живых организмов, их родстве. Все доказательства эволюции можно сгруппировать на следующие:

1. Эмбриологические доказательства эволюции.

2. Морфологические доказательства эволюции.

3. Палеонтологические доказательства эволюции.

4. Биогеографические доказательства эволюции.

5. Молекулярно-биологические доказательства эволюции.

 1. Эмбриологические доказательства эволюции. На изумительное сходство эмбрионов позвоночных животных было обращено внимание многих исследователей задолго до Ч. Дарвина. Нельзя объяснить сходство эмбрионов аналогичными условиями их развития.

Сходство между эмбрионами сохраняется вопреки глубоким различиям в условиях их развития. Это сходство есть прямое подтверждение родства и единства происхождения организмов.

Открытый Карлом Бэром (1792-1876 гг.) закон зародышевого сходства гласит, что чем более ранние стадии индивидуального развития исследуются, тем больше сходства обнаруживается между различными организмами.

В процессе онтогенеза повторяются (рекапитулируют) многие черты строения предковых форм: на ранних стадиях – более отдалённых предков, на поздних стадиях – близких предков. У всех позвоночных на определённой стадии развития существует хорда. У многих насекомых личиночная стадия (гусеница – личинка) напоминает червей.

Обобщённые данные позволили немецким учёным Ф. Мюллеру (1822-1897 гг.) и Э. Геккелю (1834-1919 гг.) сформулировать биогенетический закон: онтогенез (индивидуальное развитие) есть краткое и сжатое повторение филогенеза (исторического развития вида).

Биогенетический закон был развит и уточнён российским учёным А.Н. Северцовым (1866-1936 гг.), показавшим, что в онтогенезе повторяются стадии не взрослых предков, а их эмбриональных стадий; филогенез – это исторический ряд выбранных в ходе естественного отбора онтогенезов.

2. Морфологические доказательства эволюции основываются на присутствии у многих живых организмов гомологии в строении органов, наличии рудиментарных и атавистических органов.

Гомологичные органы – это органы, имеющие сходный план строения, выполняющие как сходные, так и различные функции и развивающиеся из сходных зачатков. Различные по внешнему виду и функциям конечности млекопитающих имеют сходный план строения и формирования: кости плеча, предплечья, запястья, пясти, фаланг пальцев. Изучение анатомии черепа в ряду высших и низших позвоночных позволило установить гомологию костей черепа у рыб и слуховых косточек у млекопитающих.

Рудиментарные органы (лат. rudimentum – зачаток, первооснова) – это органы, утратившие в филогенезе своё значение и функцию и остающиеся у организмов в виде недоразвитых образований. Рудиментарные косточки у китообразных на месте тазового пояса указывают на происхождение китов и дельфинов от типичных четвероногих. Рудиментарные задние конечности питона свидетельствуют о его происхождении от организмов с развитыми конечностями. Рудиментами человека являются: копчиковые позвонки, мигательная перепонка (остаток третьего века), остатки волосяного покрова по всему телу, аппендикс – отросток слепой кишки, сильно развитые ушные мышцы, позволяющие двигать ими.

Атавистический орган (лат. atavus – предок) – это орган (или структура), показывающий «возврат к предкам», в норме не встречающийся у современных форм.

Атавизмами человека являются: многососковость, гипертрихоз (обильное оволосенение тела и лица), сильное развитие клыков и зубы мудрости, случаи рождения детей с небольшим мягким хвостиком, полидактилия (многопальцевость) кистей и стоп, развитие человеческого зародыша с одним глазом.

Отличия рудиментов от атавизмов: 1) рудименты встречаются у всех особей популяции, атавизмы – у отдельных индивидов; 2) рудимент всегда имеет определённую функцию, атавизм не имеет специальных функций, важных для вида.

3. Палеонтологические доказательства эволюции включают в себя нахождение и изучение ископаемых переходных форм, составление палеонтологических рядов эволюции организма во времени.

Ископаемые переходные формы – формы организмов, сочетающие признаки более древних и молодых групп. Находки и описание таких форм позволяют восстанавливать филогенез отдельных групп. Ихтиостега – ископаемая форма, которая позволяет связать рыб с наземными позвоночными. Археоптерикс – переходная форма от рептилий к птицам юрского периода.

Признаки археоптерикса, сближающие его с рептилиями:

— длинный хвост с несросшимися позвонками,

— брюшные рёбра,

— развитые зубы.

Признаки археоптерикса, сближающие его с птицами:

— тело покрыто перьями,

— передние конечности превращены в крылья.

Палеонтологические ряды – это ряды ископаемых форм, связанные друг с другом в процессе эволюции и отражающие ход филогенеза.

Владимир Онуфриевич Ковалевский (1842-1883 гг.) – известный русский зоолог, основоположник эволюционной палеонтологии. Автор классической реконструкции филогенетического ряда лошадей. Наличие многих последовательно сменяющих друг друга форм позволило построить филогенетический ряд от эогиппуса до современной лошади.

4. Биогеографические доказательства эволюции основываются на сравнении флоры и фауны различных материков, островов, выявлении реликтовых растений и животных.

Различия или сходства состава флоры и фауны могут быть связаны со временем геологического разделения материков.

Австралия на протяжении более 120 млн. лет не соединялась с другими материками. В этот период происходило формирование особой фауны, развивались сумчатые и клоачные млекопитающие.

Следы геологического единства Южной Америки, Африки, острова Мадагаскар сохраняются в современной фауне. Например, ящерицы-игуаны Мадагаскара и Южной Америки.

Реликтовые формы – это ныне живущие виды с комплексом признаков, характерных для давно вымерших групп прошлых эпох. Реликтовые формы свидетельствуют о флоре и фауне далёкого прошлого Земли.

Гаттерия – рептилия, обитающая в Новой Зеландии. Этот вид является единственным ныне живущим представителем подкласса Первоящеров в классе Рептилий.

Латимерия (целокант) – кистеперая рыба, обитающая в глубоководных участках у берегов Восточной Африки. Единственный представитель отряда Кистеперых рыб, наиболее близкий к наземным позвоночным.

Гинкго двулопастный – реликтовое растение. В настоящее время распространено в Китае и Японии только как декоративное растение. Облик гинкго позволяет представить древесные формы, вымершие в юрском периоде.

5. Молекулярно-биологические доказательства эволюции. Изучение строения нуклеиновых кислот и белков. Процесс эволюции на молекулярном уровне связан с изменением состава нуклеотидов в ДНК и РНК, а также аминокислот в белках. «Молекулярные часы эволюции» – понятие, введённое американскими исследователями Э. Цукер-Кандлем и Л. Поллингом. Изучая закономерности эволюции белков, исследователи пришли к выводу, что для каждого конкретного типа белков скорость эволюции своя, и она постоянна. (Говоря об эволюции белка, мы подразумеваем соответствующий ген).

Медленно изменяются, то есть являются консервативными уникальные гены, кодирующие жизненно важные белки (глобин, цитохром – дыхательный фермент и др.).

Некоторые белки вируса гриппа эволюционируют в сотни раз быстрее, чем гемоглобин или цитохром. Благодаря этому к вирусу гриппа не формируется прочный иммунитет.

Сравнение аминокислотной последовательности в белках рибосом, последовательности нуклеотидов рибосомных РНК у разных организмов подтверждает классификацию основных групп организмов.

IV. Обобщение и закрепление изученного.

Доказательства эволюции – свидетельство объективности процесс а исторического развития органического мира.

1. Как вы думаете, в какой хронологической последовательности происходило накопление фактов, доказывающих реальность эволюции, разными биологическими дисциплинами: эмбриологией, морфологией, палеонтологией, биогеографией, молекулярной биологией?

2. Являются ли аналогичные органы доказательством эволюционного процесса? Почему?

3. На ранних стадиях эмбрионального развития зародыши птиц выделяют в качестве конечного продукта азотистого обмена аммиак, на более поздних – мочевину, на последних стадиях – мочевую кислоту. У головастиков конечным продуктом азотистого обмена является аммиак, а у взрослых амфибий – мочевина. О чём свидетельствуют эти факты?

4. О чём свидетельствует обнаружение на островах Галапагосского архипелага большого количества эндемичных видов птиц и рептилий?

5. Можно ли считать утконоса и ехидну промежуточными формами? Какие признаки объединяют их с пресмыкающимися, а какие свидетельствуют об их принадлежности к классу млекопитающих?

6. Как с точки зрения закономерностей наследственности можно объяснить появление атавизмов?

7. Определите, какие из перечисленных в таблице органов растений и животных являются гомологичными, а какие аналогичными.

Морфологические признаки организмов

Гомологичные органы

Аналогичные органы

Крылья птицы и бабочки

Жабры речного окуня и речного рака

Передние конечности крота и лошади

Роющие конечности крота и насекомого медведки

Резцы грызунов и зайцеобразных

Конечности таракана и паука

Глаз головоногого моллюска и птицы

Крылья летучей мыши и бабочки

V. Домашнее задание.

§ 43, с. 157 задания № 2 и 4 письменно в тетради.

Ученые ответили на ключевой вопрос о происхождении жизни

https://ria.ru/20210302/rnk-1599578290.html

Ученые ответили на ключевой вопрос о происхождении жизни

Ученые ответили на ключевой вопрос о происхождении жизни — РИА Новости, 02.03.2021

Ученые ответили на ключевой вопрос о происхождении жизни

Немецкие биологи экспериментально доказали, что молекулы транспортной РНК могли стать главным элементом в эволюции ранних форм жизни. При определенных условиях… РИА Новости, 02.03.2021

2021-03-02T12:57

2021-03-02T12:57

2021-03-02T12:57

наука

германия

жизнь

биология

/html/head/meta[@name=’og:title’]/@content

/html/head/meta[@name=’og:description’]/@content

https://cdnn21.img.ria.ru/images/07e4/0a/0f/1579963239_0:0:1440:810_1920x0_80_0_0_02d0eb923ab3b8b47bea14d3761ae384.jpg

МОСКВА, 2 мар — РИА Новости. Немецкие биологи экспериментально доказали, что молекулы транспортной РНК могли стать главным элементом в эволюции ранних форм жизни. При определенных условиях они способны собираться в функциональные единицы, воспроизводящие генетическую информацию в геометрической прогрессии . Результаты исследования опубликованы в журнале eLIfe.Жизнь, как мы ее знаем, основана на сложной сети взаимодействий в биологических клетках, реализующих передачу генетической информации от нуклеиновых кислот к белкам. Этот процесс универсален для всех без исключения клеточных организмов, он лежит в основе биосинтеза макромолекул.Передача генетической информации осуществляется последовательно: сначала от ДНК к РНК (этот процесс называется транскрипцией), а затем на матрице РНК реализуется синтез белка (трансляция). В операции, известной как репликация, белки дублируют генетическую информацию, закодированную в молекулах ДНК и хранящуюся в ядре клетки, распределяют ее поровну между двумя дочерними клетками во время деления, и процесс повторяется.Парадокс центральной догмы молекулярной биологии заключается в том, что уже на первом этапе в качестве катализаторов транскрипции выступают сложные белковые соединения — ферменты: в определенном участке двойная спираль ДНК под действием ферментов раскручивается, и одна из цепочек становится матрицей для построения так называемой матричной, или информационной РНК (мРНК), которая потом участвует в трансляции. То есть, и на молекулярном уровне встает извечный вопрос о происхождении жизни — что было первично — яйцо или курица: белки необходимы для передачи генетической информации, но сам их синтез зависит от транскрипции.Биологи из Мюнхенского университета имени Людвига и Максимилиана впервые экспериментально доказали, что небольшие изменения в молекулах транспортной РНК (тРНК) позволяют им самостоятельно собираться в функциональную единицу, которая может воспроизводить информацию.Таким образом, по мнению ученых, транспортная РНК, действующая как посредник между мРНК и белками, могла быть ключевым элементом в эволюции ранних форм жизни: молекулы тРНК могли автономно взаимодействовать между собой с образованием своего рода модуля репликации, способного экспоненциально реплицировать информацию.»Наши исследования ранних форм молекулярной репликации и наше открытие связи между репликацией и трансляцией приближают нас к реконструкции происхождения жизни», — приводятся в пресс-релизе университета слова одного из авторов исследования Дитера Брауна (Dieter Braun).Чтобы такая система заработала, нужна неравновесная среда для запуска соответствующих физических и химических процессов, считают ученые. Поэтому все их эксперименты включали повторяющуюся последовательность температурных колебаний.Каждый эксперимент начинался с шаблона — информационной структуры, состоящей из двух типов центральных нуклеотидных последовательностей. Исследователи продемонстрировали, что при периодически меняющихся условиях шаблонная бинарная структура может многократно копироваться.»Вполне вероятно, что такой механизм репликации имел место в гидротермальной микросистеме на ранней Земле», — говорит Браун.В частности, по мнению авторов, благоприятная среда для таких реакционных циклов, могла сложиться в пористых породах на морском дне, где естественные колебания температуры связаны с конвекционными токами.

https://ria.ru/20200807/1575506512.html

https://ria.ru/20210217/mamont-1597883090.html

германия

РИА Новости

[email protected]

7 495 645-6601

ФГУП МИА «Россия сегодня»

https://xn--c1acbl2abdlkab1og.xn--p1ai/awards/

2021

РИА Новости

[email protected]

7 495 645-6601

ФГУП МИА «Россия сегодня»

https://xn--c1acbl2abdlkab1og.xn--p1ai/awards/

Новости

ru-RU

https://ria.ru/docs/about/copyright.html

https://xn--c1acbl2abdlkab1og.xn--p1ai/

РИА Новости

[email protected]

7 495 645-6601

ФГУП МИА «Россия сегодня»

https://xn--c1acbl2abdlkab1og.xn--p1ai/awards/

https://cdnn21.img.ria.ru/images/07e4/0a/0f/1579963239_0:0:1080:810_1920x0_80_0_0_b5f5f6b209b6174643d81992fb5f7d32.jpg

РИА Новости

[email protected]

7 495 645-6601

ФГУП МИА «Россия сегодня»

https://xn--c1acbl2abdlkab1og.xn--p1ai/awards/

РИА Новости

[email protected]

7 495 645-6601

ФГУП МИА «Россия сегодня»

https://xn--c1acbl2abdlkab1og.xn--p1ai/awards/

германия, жизнь, биология

МОСКВА, 2 мар — РИА Новости. Немецкие биологи экспериментально доказали, что молекулы транспортной РНК могли стать главным элементом в эволюции ранних форм жизни. При определенных условиях они способны собираться в функциональные единицы, воспроизводящие генетическую информацию в геометрической прогрессии . Результаты исследования опубликованы в журнале eLIfe.

Жизнь, как мы ее знаем, основана на сложной сети взаимодействий в биологических клетках, реализующих передачу генетической информации от нуклеиновых кислот к белкам. Этот процесс универсален для всех без исключения клеточных организмов, он лежит в основе биосинтеза макромолекул.

Передача генетической информации осуществляется последовательно: сначала от ДНК к РНК (этот процесс называется транскрипцией), а затем на матрице РНК реализуется синтез белка (трансляция). В операции, известной как репликация, белки дублируют генетическую информацию, закодированную в молекулах ДНК и хранящуюся в ядре клетки, распределяют ее поровну между двумя дочерними клетками во время деления, и процесс повторяется.

Парадокс центральной догмы молекулярной биологии заключается в том, что уже на первом этапе в качестве катализаторов транскрипции выступают сложные белковые соединения — ферменты: в определенном участке двойная спираль ДНК под действием ферментов раскручивается, и одна из цепочек становится матрицей для построения так называемой матричной, или информационной РНК (мРНК), которая потом участвует в трансляции.

То есть, и на молекулярном уровне встает извечный вопрос о происхождении жизни — что было первично — яйцо или курица: белки необходимы для передачи генетической информации, но сам их синтез зависит от транскрипции.

7 августа 2020, 19:22НаукаЯпонские ученые открыли внеземное происхождение многообразия жизни

Биологи из Мюнхенского университета имени Людвига и Максимилиана впервые экспериментально доказали, что небольшие изменения в молекулах транспортной РНК (тРНК) позволяют им самостоятельно собираться в функциональную единицу, которая может воспроизводить информацию.

Таким образом, по мнению ученых, транспортная РНК, действующая как посредник между мРНК и белками, могла быть ключевым элементом в эволюции ранних форм жизни: молекулы тРНК могли автономно взаимодействовать между собой с образованием своего рода модуля репликации, способного экспоненциально реплицировать информацию.

«Наши исследования ранних форм молекулярной репликации и наше открытие связи между репликацией и трансляцией приближают нас к реконструкции происхождения жизни», — приводятся в пресс-релизе университета слова одного из авторов исследования Дитера Брауна (Dieter Braun).

Чтобы такая система заработала, нужна неравновесная среда для запуска соответствующих физических и химических процессов, считают ученые. Поэтому все их эксперименты включали повторяющуюся последовательность температурных колебаний.

Каждый эксперимент начинался с шаблона — информационной структуры, состоящей из двух типов центральных нуклеотидных последовательностей. Исследователи продемонстрировали, что при периодически меняющихся условиях шаблонная бинарная структура может многократно копироваться.

«Вполне вероятно, что такой механизм репликации имел место в гидротермальной микросистеме на ранней Земле», — говорит Браун.

В частности, по мнению авторов, благоприятная среда для таких реакционных циклов, могла сложиться в пористых породах на морском дне, где естественные колебания температуры связаны с конвекционными токами.

17 февраля, 19:00НаукаПолучена древнейшая ДНК мамонта возрастом более миллиона лет

Мультимедийные презентации по теме «Свидетельства эволюции» для уроков биологии в 11 классе общеобразовательной школы

СВИДЕТЕЛЬСТВА ЭВОЛЮЦИИ (Факты, доказывающие эволюционный процесс)

Презентация к уроку биологии в 11 классе (по учебнику «Биология. 11 класс : базовый уровень / под ред. Д.К. Беляева и Г.М. Дымшица. – М. : Просвещение, 2014)

Автор: Лысенко И.П., учитель биологии СОШ № 15

  • Свидетельства эволюции (факты, доказывающие эволюционный процесс) — научные данные и концепции, подтверждающие эволюцию органического мира на Земле.
  • Различные биологические науки представляют свои свидетельства.

ОСНОВНЫЕ СВИДЕТЕЛЬСТВА ЭВОЛЮЦИИ

Палеонтологические

Морфологические

Биогеографические

Эмбриологические

Молекулярные

Биохимические

Генетические

МОЛЕКУЛЯРНЫЕ СВИДЕТЕЛЬСТВА ЭВОЛЮЦИИ

Биохимические

Генетические

Биохимия — …

Генетика — …

Геном человека

Единый механизм хранения наследственной информации

Для всех живых организмов существует единый генетический код : три нуклеотида (триплет) кодируют одну аминокислоту.

В 1968 г. американский ученый Маршалл Ниренберг (1927-2010) за расшифровку генетического кода был удостоен Нобелевской премии.

Единый механизм реализации наследственной информации

ДНК

Первичные структуры белков клетки

Третичные структуры

Функции белков

Особенности клетки

Транскрипция — …

Трансляция — …

Схема синтеза белка в клетке

Единый механизм передачи наследственной информации

В основе размножения организмов лежит деление клеток.

Митоз — …

Мейоз — …

Биологический смысл

из одной диплоидной (2n)

из одной диплоидной (2n)

4 гаплоидные (n) клетки

2 диплоидные (2n) клетки

«Молекулярные часы эволюции»

Процесс эволюции на молекулярном уровне связан с изменением состава нуклеотидов в ДНК и РНК, а также аминокислот в белках.

«Молекулярные часы эволюции» — понятие, введенное американскими исследователями Э.Цукер-Кандлем и Л.Поллингом.

Изучая закономерности эволюции белков, исследователи пришли к выводу, что для каждого конкретного типа белков скорость эволюции своя, и она постоянна. (Говоря об эволюции белка, мы подразумеваем соответствующий ген).

Медленно изменяются, то есть являются консервативными уникальные гены, кодирующие жизненно важные белки (глобин, цитохром – дыхательный фермент и др.).

Некоторые белки вируса гриппа эволюционируют в сотни раз быстрее, чем гемоглобин или цитохром. Благодаря этому к вирусу гриппа не формируется прочный иммунитет.

Сравнение аминокислотной последовательности в белках рибосом, последовательности нуклеотидов рибосомных РНК у разных организмов подтверждает классификацию основных групп организмов.

ГЕНЕТИЧЕСКАЯ ЛЕТОПИСЬ ЭВОЛЮЦИИ

Мутация – стойкое изменение генотипа

генные

геномные

хромосомные

Чем больше поколений отделяет современные виды от их общего предка,

тем больше мутаций.

Геном вида – генетическая летопись эволюции.

Различия аминокислотного состава молекул гемоглобина у представителей разных таксонов

Чем дальше разошлись виды, происходящие от общего предка, тем больше у таких видов будут различаться одни и те же белки по аминокислотному составу.

ФИЛОГЕНЕТИЧЕСКОЕ ДРЕВО

Филогенетическое древо – диаграмма в форме древа, отражающая происхождение видов живых организмов от общего предка.

Расшифровка геномов видов животных и растений позволили уточнить филогенетическое древо, построенное на основе морфологических признаков.

Так, генетики пересмотрели родину сумчатых. Сравнение не так давно расшифрованных геномов кенгуру и опоссума принесло весьма необычный результат. Германские учёные из Вестфальского университета Вильгельма выяснили, что все сумчатые произошли от предка, который проживал на территории современной Южной Америки.

Умникам и умницам

  • Подумайте, что изучает одно из направлений молекулярной биологии -молекулярная филогения.
  • Найдите информацию об изменении филогенетического древа отдельных видов животных и растений на основе молекулярно-генетического анализа.

Как прочитать эволюцию по генам?

Статья на конкурс «био/мол/текст»: Проникновение в тайны эволюции — одно из самых захватывающих направлений в современной биологии. Однако тут есть небольшая проблема: пока не изобретена машина времени, чтобы можно было своими глазами увидеть, как развивалась жизнь на Земле. Впрочем, в наше время существуют методики, которые позволяют приподнять завесу тайны над эволюцией, и одна из основных среди них — построение филогении всего живого, то есть «древа жизни». Для этого можно использовать различные признаки, главный среди которых — это последовательность ДНК, в которой закодировано все разнообразие современных и ископаемых существ. В этой статье рассказывается о методиках построения таких филогений, частично заменяющих ученым машину времени.

Эта статья представлена на конкурс научно-популярных работ «био/мол/текст»-2013 в номинации «Лучший обзор».


Спонсор конкурса — дальновидная компания Thermo Fisher Scientific. Спонсор приза зрительских симпатий — фирма Helicon.

Что такое филогения и филогенетический анализ?

Филогения всех живых существ, или древо жизни, является нашим представлением о степени родства организмов и о том, как шла эволюция живых существ. Кто является ближайшим родственником человека, и каким был наш общий предок? Вымерли ли динозавры, или их потомки до сих пор живут рядом с нами? Произошли ли теплокровность и способность к полету среди позвоночных единожды? Откуда вообще взялись позвоночные? На все эти вопросы уже есть ответы, и получены они были главным образом с помощью филогенетического анализа.

Филогения фактически является той основой, на которую «навешиваются» знания об организмах. Именно она наделяет биологию важным качеством — предсказательностью. Зная те или иные свойства организмов одного вида, с помощью филогении мы можем судить о свойствах родственных ему существ, и даже проследить эволюцию признаков. Древо жизни используется не только в теоретической биологии, но также и в прикладных науках. Например, в медицине и фармакологии филогении используются для того, чтобы понять, откуда были завезены тe или иные вирусы или бактерии, и какие лекарства на них действуют лучше всего [19].

Построение древа жизни является задачей вовсе не тривиальной, и это направление науки, как ни странно, можно считать относительно новым. Разные исследователи пытались проанализировать родственные отношения организмов с самых ранних времен, однако настоящая филогенетическая «революция» случилась только в 50—60-х годах XX века. До 80-х годов деревья строились главным образом на основании морфологических данных, но привлечение ДНК было лишь вопросом времени, поскольку именно в этой молекуле закодированы все признаки организма.

Немного о ДНК

Чтобы понять, как анализируют ДНК, надо вспомнить, как она устроена. ДНК, или дезоксирибонуклиновая кислота, — это очень длинная молекула, которая находится в ядре клетки. ДНК, как правило, состоит из двух закрученных спиралей, а каждая спираль состоит из множества нукеотидов. Нуклеотиды по большей части отличаются друг от друга азотистыми основаниями, которых в ДНК всего четыре: аденин, тимин, гуанин и цитозин. Именно нуклеотиды создают слабые химические связи, которыми соединяются спирали ДНК. Аденин одной спирали связывается с тимином другой спирали, а гуанин связывается с цитозином (рис. 1). Мутация происходит, когда одно основание заменяется на любое другое. Чаще всего замены происходят в парах аденин—гуанин и тимин—цитозин.

Рисунок 1. ДНК. A — аденин, C — цитозин, G — гуанин, T — тимин.

В ДНК есть последовательности нуклеотидов, которые кодируют белки, и есть участки, которые ничего не кодируют. Кодирующие последовательности — это гены. Они могут быть разной длины, но чаще всего имеют определенную структуру, по которой можно сказать — ген это или нет. Именно гены обычно используют для филогенетического анализа.

Основные принципы построения филогений

Наверное, самое главное правило, которым руководствуются для построения филогений в наше время — это принцип дихотомии: считается, что из трех таксонов, два должны быть более родственны друг другу, чем третий. Поэтому филогении обычно выглядят как дихотомически разветвленные деревья. Если порядок ветвления установлен для всего дерева, то говорят, что оно полностью разрешенное. Иногда в филогениях бывают «кусты» или политомии — это те места, где порядок ветвления неясен, тогда говорят, что дерево не полностью разрешенное. Этот принцип несовершенен, потому что эволюция таксонов далеко не всегда происходит дихотомически. Когда становится понятно, что дихотомия не отражает реальный случай, исследователи привлекают другие схемы — например, филогенетические сети [8].

Методы построения филогений еще в 60-х годах XX века разделились на две основные ветви — фенетические и кладистические. В то время анализ родственных связей основывался на морфологических признаках [12]; с привлечением к построению филогений молекулярных признаков основные принципы анализа родственных связей остались фактически теми же.

  • В фенетике построение филогении основано на общем сходстве двух видов — то есть, чем больше общих признаков, тем ближе они друг к другу;
  • В кладистике же считается, что только уникальные для какой-либо группы признаки можно использовать для оценки родства таксонов. Родоначальником кладистического анализа является немецкий ученый Вилли Хенниг [6]. Этот автор также ввел и терминологию, которая широко используется до сих пор. Уникальные признаки называются апоморфиями; ветви, которые объединяются апоморфиями — это клады; а сама филогения называется кладограммой (рис. 2) [12].

Чтобы было более понятно, представьте три вида животных: домашнюю мышь, сумчатую мышь и кенгуру. Домашняя мышь и сумчатая мышь очень похожи друг на друга внешне, но у сумчатой мыши и кенгуру есть общая апоморфия — сумка, — что говорит о том, что эти два вида родственные. Но, естественно, филогенетический анализ основывается на гораздо большем количестве признаков, и группы могут иметь несколько апоморфий.

Рисунок 2. Полностью разрешенная кладограмма. Каждое ветвление — это клада. Обозначенные признаки являются апоморфиями.

Первые шаги. ДНК—ДНК гибридизация

Первые попытки использовать ДНК в качестве основы для построения древа жизни были фенетическими. В 1984 году американские ученые Сибли и Алкист [13] впервые попытались использовать ДНК для прояснения филогении различных видов приматов. Они применили технологию, которая называется «ДНК—ДНК гибридизация». Метод основывается на том, что при копировании в ДНК постоянно происходят мутации. Это приводит к тому, что даже у двух близких родственников последовательности ДНК будут отличаться, не говоря уже о видах. Иными словами, чем дальше находятся организмы на филогенетическом древе, тем больше у них различается ДНК. В данном методе одиночные молекулы ДНК двух видов смешиваются, чтобы они могли образовать «гибридные» двойные спирали, в которых одна половина принадлежит одному виду, а вторая — другому. Затем такие «гибриды» нагреваются, и исследователь смотрит, при какой температуре двойная спираль распадается (или диссоциирует) на две части. Считается, что чем выше температура, требующаяся для распада «гибрида», тем прочнее связь молекул ДНК двух разных видов, и, соответственно, тем ближе эти виды друг к другу (рис. 3).

Рисунок 3. ДНК—ДНК гибридизация. а — Нагревание ДНК двух видов, в результате которого двойная спираль распадается на две части. б — Охлаждение ДНК, в результате которого молекулы ДНК разных видов гибридизуются друг с другом. в — Нагревание ДНК, в результате которого гибридные молекулы ДНК распадаются.

Очень быстро стало понятно, что такой метод не может быть очень точным. Дело в том, что гены могут гибридизоваться не только с гомологичными им генами (гены-ортологи), но и с копиями этих генов, которых в геноме может быть довольно много (гены-паралоги) [15]. Постепенно, с развитием методики секвенирования генов , главным источником для построения филогений стали последовательности ДНК или белков, записанные в виде компьютерных файлов. В последние годы скорость накопления генетической информации растет все увеличивающимися темпами, что окончательно утверждает филогению как метод анализа и обработки биологических текстов.

Метод матрицы расстояний (distance matrix)

Метод матрицы расстояний, по сути, является фенетическим. Его основа — расчет попарных различий между соответствующими генами всех видов, участвующих в таком анализе. Делается это следующим образом: гены каждого анализируемого вида сравниваются по каждой позиции нуклеотидов, и чем больше найдено отличий, тем больше будет «расстояние» между видами. Затем строится матрица, в которую заносится это значение для каждой возможной пары сравниваемых генов. Далее матрица расстояний является входной информацией для алгоритмов построения деревьев.

Самый популярный среди подобных алгоритмов — это метод ближайших соседей (neighbour joining). Среди анализируемых видов находят два с минимальными различиями в последовательности (т.е., максимально похожие). Исходя из составленной матрицы, данные об этих видах «объединяются», и далее они участвуют в анализе в объединенном состоянии. Виды один за другим проходят эту процедуру до тех пор, пока не будет найдено одно, полностью разрешенное дерево. Этот алгоритм хорош тем, что он относительно прост и подходит для обработки больших наборов данных (рис. 4) [3].

Рисунок 4. Метод ближайшего соседа

Разные авторы, однако, перечисляют некоторые минусы метода ближайших соседей. Например, есть мнение, что этот метод хуже работает с таксонами, которые филогенетически далеки друг от друга [4], [17]. Также недостатком можно считать и то, что метод всегда выдает дерево с одним-единственным возможным вариантом ветвления [3]. Это происходит потому, что алгоритм подразумевает построение одной филогении без сравнения с другими, тогда как в кладистических методах оцениваются деревья с различным порядком ветвления. Несмотря на то, что в серьезных филогенетических анализах методы матрицы расстояний сейчас почти не используются, они применяются, например, для быстрого построения филогений близкородственных бактерий и вирусов [18].

Метод наибольшей экономии (maximum parsimony)

Этот подход получил большую популярность при анализе морфологических данных, а также какое-то время применялся и для молекулярных исследований. Первый этап анализа — это создание матрицы признаков. Каждый признак должен иметь хотя бы два состояния. Состояний может быть больше, в морфологии они могут описывать разные формы и структуры. Если на кладограмме у какого-то таксона или группы таксонов состояние отличается от предкового, то это называется «переходом из одного состояния в другое». Суть этого алгоритма в том, чтобы найти такое дерево, где присутствует наименьшее суммарное число переходов из одного состояния в другое для всех признаков. В этом случае кладограмма и отображаемая на ней эволюция будут считаться наиболее экономными, а, значит, и более вероятными [3], [12], [16], [17].

Тут возникает вопрос: почему мы вообще считаем, что эволюция должна быть экономной? Дело в том, что это соответствует главному методологическому принципу науки, который заключается в том, что из нескольких равновероятных объяснений надо выбирать наиболее простое, с привлечением как можно меньшего количества сущностей. Этот метод еще называется «Бритвой Оккама». В одной из книг по филогении [3] есть шутливый пример. Представьте, что в одном и том же городе где-то в Северной Америке в соответствующую службу поступает два звонка о том, что по улицам гуляет тигр. Понято, что легче всего предположить, что это один и тот же тигр, который сбежал из зоопарка. Гипотеза, что в городе, где тигров в природе никогда не было, откуда-то появилось сразу же два таких хищника, гораздо менее вероятна.

Эволюция признака — тоже событие нечастое, и когда мы видим два похожих по строению органа, то мы предполагаем, что орган произошел один раз [3]. Это не означает, что признак действительно произошел только один раз, просто это наиболее вероятно. Кладограмма строится на основании многих признаков, и чем больше апоморфий характеризует ту или иную ветвь, тем больше доверия она вызывает.

Плюс метода наибольшей экономии в том, что он интуитивно понятен и довольно прост, но в молекулярных анализах он очень быстро потерял популярность. Один из его недостатков в том, что он не учитывает длину ветвей, которая отображает количество замен нуклеотидов во время эволюции той или иной клады [3]. Некоторые ветви на дереве будут длиннее, потому что скорость эволюции там была выше. При использовании метода наибольшей экономии длинные ветви будут «притягиваться» друг к другу. Этот феномен возникает потому, что чем больше замен нуклеотидов в двух ветвях, тем выше шанс на то, что некоторые из них случайно совпадут, и будут расцениваться как общие апоморфии, даже если это абсолютно не соответствует реальному положению дел.

Другой минус в том, что метод не учитывает разные модели замены нуклеотидов [17]. Например, в методе наибольшей экономии аденин имеет одинаковую вероятность уступить место как тимину, так и цитозину, хотя, как уже отмечалось выше, в организме аденин скорее заменится на цитозин, чем на тимин.

Методы, основанные на моделях эволюции

Наиболее часто используемые методы построения филогений на основе молекулярных данных основываются на моделях эволюции. Один из первых стал метод максимального правдоподобия (maximum likelihood). Для расчета кладограммы, помимо последовательности ДНК, надо выбрать модель замены нуклеотидов, на основании которой будут рассчитываться вероятности. Также в расчет берется длина ветви или эволюционная дистанция между двумя таксонами. Во время анализа рассчитывается, какая длина ветви наиболее вероятна с точки зрения выбранной модели, вероятности всех ветвей кладограммы умножаются, и кладограмма, имеющая наибольшую вероятность, считается правильной [3], [16], [17].

Последний и, наверное, самый популярный в наше время метод — это Байесовский вывод (Bayesian inference). Он, в общем, похож на метод максимального правдоподобия, поскольку также основывается на модели и длине ветвей. Но отличие Байесовского вывода в том, что тут берется в расчет еще один фактор — апостериорная вероятность (posterior probablity), которая рассчитывается на основании как исходных данных, так и полученных результатов анализа [3], [16], [17]. Это не очень понятно интуитивно, но суть в том, что в ходе анализа исследователь получает новые данные, которые тоже можно применить.

Приведу очень простой пример. Пусть у нас есть мешок с сотней шариков, половина их которых красные и половина — белые. Изначально вероятность вытащить шарик как белого, так и красного цвета равна 50%. Но, допустим, мы вытащили 20 красных и 40 белых шариков, и в мешке остались 30 красных и 10 белых шариков. Это означает, что к текущему моменту шанс вытащить красный шарик равен 75%, а белый — 25%, что кардинальным образом отличается от исходного состояния. В Байесовском выводе используются похожая логика, хотя, конечно же, расчеты там гораздо сложнее.

Несмотря на все видимые плюсы двух последних методов, тут тоже можно найти некоторые сложности. Главная их слабость в том, что каждый исследователь вынужден подбирать модели самостоятельно, и совсем не обязательно, что он сделает выбор правильно. Но у этой проблемы есть решение. Во-первых, есть программы, которые могут помочь подобрать модель; во-вторых, уже есть алгоритмы на основе Байесовского метода, которые могут «прыгать» с модели на модель, тем самым тестируя их. Еще одна проблема, скорее всего, решаемая с развитием техники, заключается в том, что обсчеты филогений с использованием последних двух методов довольно сложные и требуют много времени и хороших компьютеров.

Все же насколько достоверны филогении?

Думаю, что внимательный читатель заметил, что многие перечисленные методы основаны на вероятностях, и у него может возникнуть закономерный вопрос: как можно доверять филогении, если всегда есть шанс, что построенное дерево ошибочно и не соответствует действительному ходу эволюции? Действительно, методы несовершенны, но на этот вопрос ответ есть.

Во-первых, в филогенетических методах есть понятие «поддержка: чем больше уникальных признаков поддерживают дерево или какую-то его ветвь, тем больше доверия они вызывают [12]. Само дерево может иметь низкую поддержку, зато свидетельств в пользу отдельных его ветвей может быть так много, что корректность не вызовет сомнений. Для подтверждения результата исследователи могут использовать совокупности признаков: последовательности ДНК, РНК и белков, морфологические данные, особенности поведения организмов и многое другое [11]. Когда независимые признаки подтверждают друг друга, уверенность в результате гораздо выше.

Второй ответ на поставленный вопрос еще более обнадеживающий. Его дают эксперименты, проведенные на разных организмах, для которых известна генеалогия, то есть настоящая эволюционная история [1], [5], [7], [10]. Можно привести в пример опыт с мышами, когда филогенетический анализ провели на основе ДНК 24-х линий этих животных. Оказалось, что наблюдаемая последовательность поколений и полученная филогения почти полностью соответствуют друг другу [1]. Это значит, что используемые методы как минимум способны правильно отображать эволюцию.

Плюсы и минусы молекулярных методов построения филогений

У молекулярных методов есть много преимуществ перед морфологическим анализом. Во-первых, ДНК содержит в себе множество данных, которые можно использовать в расчетах, — ведь в генах могут содержаться сотни нуклеотидов. Чаще всего для оценки родства используют больше одного гена, тогда как для анализа на основе морфологических данных используют несколько десятков признаков. Во-вторых, анализ ДНК считается более объективным. Дело в том, что морфологические признаки разные люди могут трактовать и кодировать по-разному, тогда как нуклеотиды всегда одинаковы . В-третьих, ДНК можно использовать как для анализа групп высоких рангов, так и для выяснения отношений между видами, и даже между отдельными индивидами. Морфологический же анализ более достоверен при работе с таксонами высоких рангов, чем на уровне видов, — просто потому, что чем выше ранг, тем лучше отличаются группы, и тем легче отличить аналогичный признак от гомологичного.

Несмотря на то, что преимущество молекулярного анализа кажется вполне обоснованным, есть все же и несколько причин, по которым морфологию нельзя отправить «в отставку».

Первая причина заключается в том, что не каждый организм подходит для выделения ДНК. Он должен быть собран и сохранен специальным образом, иначе эта молекула просто разрушается. Множество редких и интересных видов было описано много десятков лет назад, когда еще даже про ДНК ничего не знали, и в наши дни не очень понятно, где их искать и как собирать. В первую очередь это касается мелких членистоногих, — особенно насекомых, которых чаще всего хранят сухими. То же самое можно сказать и о палеонтологических находках вымерших видов. Для оценки родства таких групп можно использовать только морфологические методы.

Вторая причина заключается в том, что далеко не всегда результаты молекулярных филогенетических методов вызывают доверие. Иногда бывает так, что они не совпадают с устоявшимися «классическими» взглядами. Это, конечно, не означает, что именно молекулярные данные неверны, просто такие несовпадения являются «звоночком», что где-то закралась ошибка. Несовпадения могут быть не только из-за ошибок в самом анализе, но и из-за того, что были неправильно выбраны гены. Гены, мутирующие с высокой скоростью, подходят для выяснения родства между видами, но не походят для анализа групп более высоких рангов. Но гомологичные гены в разных группах организмов могут меняться с разной скоростью, поэтому гены, подходящие для анализа одной группы, могут не подходить для другой группы того же ранга. В общем, подбор нужных участков ДНК может оказаться не очень легкой работой, особенно если учесть, что далеко не все гены у всех видов хорошо изучены.

Третья причина — это высокая стоимость секвенирования генов. Для построения филогении одного небольшого рода можно легко потратить пару тысяч долларов. А если учесть, что гены не всегда подбирают правильно с первого раза, или некоторые экземпляры оказываются непригодными для секвенирования, то анализ надо проводить повторно, и цена может быть больше, чем предполагалось изначально. Анализ же на основе морфологических признаков обходится гораздо дешевле.

Анализ ДНК, безусловно, стал довольно популярным и быстроразвивающимся подходом построения филогений в наши дни. Сейчас специалисты уже используют не просто отдельные гены: в последние годы появились филогенетические исследования на основе более десятка генов или целых митохондриальных геномов [14]. Запущены проекты секвенирования целых геномов разных видов [9], а также проекты для объединения всего живого мира в единое «древо жизни» (рис. 5) [2]. В качестве частного примера можно привести исследование, в результате которого была уточнена «родословная» членистоногих [25]. Наверное, наука сейчас переживает один из самых интересных периодов в развитии анализа ДНК, когда уже видно, что это направление масштабно и многообещающе, и что есть еще очень многое, что нам предстоит узнать о геномах разных организмов. Однако насколько молекулярные методы в филогениях можно развивать, и где граница их применения — покажет будущее.

Рисунок 5. Филогения всех живых существ, или «древо жизни»

  1. W. Atchley, W. Fitch. (1991). Gene trees and the origins of inbred strains of mice. Science. 254, 554-558;
  2. Assembling Tree of Life (AToL). (2007). The National Science Foundation;
  3. Baum D.A. and Smith S.D. Tree thinking: an introduction to phylogenetic biology. Greenwood Village, CO: Roberts and Company Publishers, Inc., 2012;
  4. William J. Bruno, Nicholas D. Socci, Aaron L. Halpern. (2000). Weighted Neighbor Joining: A Likelihood-Based Approach to Distance-Based Phylogeny Reconstruction. Molecular Biology and Evolution. 17, 189-197;
  5. Douglas T. (1999-2001). 29+ Evidences for Microevolution. TalkOrigins Archive;
  6. Hennig W. Grundzüge einer Theorie der phylogenetischen Systematik. Berlin: Deutscher Zentralverlag, 1950;
  7. D. Hillis, J. Bull, M. White, M. Badgett, I. Molineux. (1992). Experimental phylogenetics: generation of a known phylogeny. Science. 255, 589-592;
  8. V. Kunin. (2005). The net of life: Reconstructing the microbial phylogenetic network. Genome Research. 15, 954-959;
  9. Jenna Morgan Lang, Aaron E. Darling, Jonathan A. Eisen. (2013). Phylogeny of Bacterial and Archaeal Genomes Using Conserved Genes: Supertrees and Supermatrices. PLoS ONE. 8, e62510;
  10. Michael M. Miyamoto, Walter M. Fitch. (1995). Testing Species Phylogenies and Phylogenetic Methods with Congruence. Systematic Biology. 44, 64;
  11. Maureen A. O’Malley, Orkun S. Soyer. (2012). The roles of integration in molecular systems biology. Studies in History and Philosophy of Science Part C: Studies in History and Philosophy of Biological and Biomedical Sciences. 43, 58-68;
  12. Schuh R.T. and Brower A.V.Z. (2003). Biological systematics: principles and applications (2nd Edition). Ithaca: Cornell University Press, 2009;
  13. Charles G. Sibley, Jon E. Ahlquist. (1984). The phylogeny of the hominoid primates, as indicated by DNA-DNA hybridization. J Mol Evol. 20, 2-15;
  14. Nan Song, Ai-Ping Liang, Cui-Ping Bu. (2012). A Molecular Phylogeny of Hemiptera Inferred from Mitochondrial Genome Sequences. PLoS ONE. 7, e48778;
  15. Mark Springer, Carey Krajewski. (1989). DNA Hybridization in Animal Taxonomy: A Critique from First Principles. The Quarterly Review of Biology. 64, 291-318;
  16. Wiley E.O. and Lieberman B.S. Phylogenetics: the theory of phylogenetic systematics (2nd Edition). Hoboken, NJ: Wiley-Blackwell, 2011;
  17. Ziheng Yang, Bruce Rannala. (2012). Molecular phylogenetics: principles and practice. Nat Rev Genet. 13, 303-314;
  18. Longyu Zheng, Tawni L. Crippen, Leslie Holmes, Baneshwar Singh, Meaghan L. Pimsler, et. al.. (2013). Bacteria Mediate Oviposition by the Black Soldier Fly, Hermetia illucens (L.), (Diptera: Stratiomyidae). Sci Rep. 3;
  19. Мамонты, кости и лекарственная устойчивость: новые технологии позволяют изучать эволюцию возбудителей инфекционных заболеваний;
  20. 454-секвенирование (высокопроизводительное пиросеквенирование ДНК);
  21. Важнейшие методы молекулярной биологии и генной инженерии;
  22. Код жизни: прочесть не значит понять;
  23. Перевалило за тысячу: третья фаза геномики человека;
  24. Огурцы-убийцы, или Как встретились Джим Уотсон и Гордон Мур;
  25. Уточнение «родословной» членистоногих.

молекулярных свидетельств | BioNinja

Понимание:

• Доказательства того, какие виды являются частью клады, могут быть получены из последовательности оснований гена или соответствующей аминокислотной последовательности

белка


Все организмы используют ДНК и РНК в качестве генетического материала, и генетический код, с помощью которого синтезируются белки, является (почти) универсальным

  • Это общее молекулярное наследие означает, что последовательности оснований и аминокислот можно сравнивать для установления определенных уровней родства


В течение миллионов лет мутации будут накапливаться в любом данном сегменте ДНК

  • Количество различий между сопоставимыми последовательностями оснований демонстрирует степень эволюционного расхождения
  • Большее количество различий между сопоставимыми последовательностями оснований предполагает, что больше времени было прошло с тех пор, как два вида разошлись
  • Следовательно, чем больше сходны последовательности оснований двух видов, тем более близкими будут эти два вида


При сравнении молекулярных последовательностей ученые могут использовать некодирующую ДНК, последовательности генов или аминокислотные последовательности

  • Некодирующая ДНК обеспечивает наилучшее средства сравнения, поскольку мутации будут происходить более легко в этих последовательностях
  • Последовательности генов мутируют с меньшей скоростью, поскольку изменения в последовательности оснований могут потенциально повлиять на структуру и функцию белка.
  • Аминокислотные последовательности также могут быть использованы для сравнения, но будут иметь самая низкая скорость изменения из-за вырожденности кодонов


Аминокислотные последовательности обычно используются для сравнения отдаленно родственных видов (т.е.е. различных таксонов), в то время как последовательности оснований ДНК или РНК часто используются для сравнения близкородственных организмов (например, разные гаплогруппы — например, разные этнические группы людей)


Сравнение бета-цепи гемоглобина у разных видов

Понимание:

• Различия в последовательностях накапливаются постепенно, поэтому существует положительная корреляция между количеством различий

между двумя видами и временем, прошедшим с момента их расхождения от общего предка


Некоторые гены или белковые последовательности могут накапливать мутации с относительно постоянной скоростью (например,грамм. 1 изменение в миллион лет)

Если эта скорость изменения достоверна, ученые могут рассчитать время расхождения в соответствии с количеством различий

  • Например. Если ген, который мутирует со скоростью 1 п.н. за 100000 лет, отличается на 6 п.н., дивергенция произошла 600000 лет назад


Эта концепция называется молекулярными часами и ограничена рядом факторов:

  • Различные гены или белки могут изменяться с разной скоростью (например,грамм. гемоглобин мутирует быстрее, чем цитохром c)
  • Скорость изменения конкретного гена может различаться в разных группах организмов
  • В течение долгого времени более ранние изменения могут быть отменены более поздними изменениями, что потенциально снижает точность прогнозов

Молекулярные часы

Молекулярное свидетельство единственного эволюционного происхождения одомашненного риса

Реферат

Азиатский рис, Oryza sativa , является одним из старейших и наиболее важных видов сельскохозяйственных культур в мире.Считается, что рис был одомашнен около 9000 лет назад, хотя споры о его происхождении остаются спорными. Модель единственного происхождения предполагает, что два основных подвида азиатского риса, indica и japonica , были одомашнены из дикого риса O. rufipogon . Напротив, модель множественного независимого одомашнивания предполагает, что эти два основных типа риса были одомашнены отдельно и в разных частях ареала видов дикого риса. Эта последняя точка зрения получила большую поддержку в результате наблюдения сильной генетической дифференциации между indica и japonica , а также нескольких филогенетических исследований одомашнивания риса.Мы повторно исследуем эволюционную историю одомашненного риса путем повторного секвенирования 630 фрагментов генов на 8, 10 и 12 хромосомах из разнообразного набора образцов дикого и одомашненного риса. Используя паттерны SNP, мы идентифицируем 20 предполагаемых выборочных зачисток этих хромосом у культивируемого риса. Демографическое моделирование, основанное на этих данных SNP, и подход, основанный на распространении, обеспечивают сильнейшую поддержку единственного происхождения риса как одомашнивания. Байесовский филогенетический анализ, реализующий слияние нескольких видов и использующий ранее опубликованные наборы данных филогенетической последовательности, также указывает на единственное происхождение азиатского одомашненного риса.Наконец, мы датируем происхождение одомашнивания примерно 8 200–13 500 лет назад, в зависимости от используемой оценки молекулярных часов, что согласуется с известными археологическими данными, которые предполагают, что рис впервые начали выращивать примерно в это время в долине Янцзы в Китае.

Одомашнивание — это сложный эволюционный процесс, в котором использование человеком видов растений и животных приводит к генетически обусловленной морфологической и / или физиологической диверсификации одомашненных таксонов от их диких предков (1).Процесс одомашнивания позволяет понять природу отбора и рост видовых различий (1). Понимание происхождения одомашненных видов влияет на наше понимание эволюционных механизмов, окружающих одомашнивание (например, события-основатели, отбор и параллельная эволюция), и культурного контекста, в котором человеческие сообщества культивируют и становятся зависимыми от определенных видов в отношении пищи, клетчатки и других целей. .

Азиатский рис, Oryza sativa L., является одним из старейших и наиболее важных видов сельскохозяйственных культур в мире, его одомашнили примерно 8 000–9 000 лет назад (2–4).Азиатский рис служит пищей более чем половине населения мира и стал ключевой модельной системой для биологии растений (5). Несколько генетических исследований показали, что O. rufipogon , сохранившееся до наших дней в Южной и Юго-Восточной Азии, является диким предком домашнего риса (6). Хотя другие предположили, что O. nivara может быть прародителем риса (7), есть данные, указывающие на то, что этот вид является однолетним экотипом O. rufipogon (6, 8, 9).

Генетический анализ показал, что рис состоит из нескольких генетически дифференцированных групп сортов, причем две основные группы — это indica и japonica (10).Иногда описываемые как подвиды, indica и japonica были признаны со времен Древнего Китая (11) и являются наиболее широко выращиваемыми сортами риса. Несколько исследований показали сильную генетическую дифференциацию между indica и japonica (8, 12–20), а молекулярные исследования предполагают оценки времени расхождения 86–440 тыс. Лет между этими двумя группами сортов (14, 15, 17, 21), намного старше, чем археологические раскопки ∼9000 лет для выращивания риса (2, 4).

Несмотря на недавние достижения в области генетики и археологии, по-прежнему ведутся споры о происхождении (-ах) домашнего риса (22, 23). За последние полвека было разработано несколько моделей, объясняющих происхождение риса; Эти модели можно в широком смысле классифицировать как отстаивающие либо одно, либо множественное происхождение этого важного вида сельскохозяйственных культур. Модели единственного происхождения утверждают, что одомашненный рис произошел от дикого риса (рис. 1), при этом дифференциация indica и japonica происходит после одомашнивания культивируемых видов (24).Молекулярные доказательства этой модели в значительной степени основаны на недавних исследованиях, которые показывают, что ключевой ген доместикации sh5 , который придает нерасщепление (25), и локус prog1 , ответственный за эрегированный привычку (26), имеют почти идентичные последовательности, общие для обоих подвидов рис. Есть также недавние молекулярные доказательства модели единственного происхождения из байесовского демографического анализа мультилокусных микросателлитных данных (27).

Рис. 1.

Схема одинарного ( A, ) vs.двойные ( B ) основательные модели. ( A ) В одном случае приручения оба одомашненных подвида произошли от одной и той же предковой популяции O. rufipogon . ( B ) В модели с двумя основателями indica и тропическая japonica были одомашнены независимо от различных популяций O. rufipogon . O. rufipogon , O. sativa ssp. indica и O. sativa ssp.тропический japonica обозначены индексами r, I и j соответственно. Времена τ B и τ представляют длину узкого места и время после него в эпоху двух популяций. Аналогичным образом, τ 2B и τ 2 представляют продолжительность узкого места и время после него для эпохи трех популяций. Симметричная миграция (μ) между популяциями представлена ​​стрелками, а N — размер популяции.

Сторонники множественного происхождения, однако, приписывают это совместное использование ключевых генов одомашнивания между indica и japonica как результат гибридизации между двумя группами сортов через некоторое время после их независимого одомашнивания (3, 22, 23). Они предлагают модель, в которой indica и japonica были одомашнены отдельно от предварительно дифференцированных предковых популяций O. rufipogon (рис. 1). Эта модель множественного происхождения может легко объяснить генетическую дифференциацию, наблюдаемую у одомашненного риса, и, таким образом, получила поддержку в филогенетических анализах, которые показывают разные клады у O.sativa для indica и japonica , с разными образцами O. rufipogon , ассоциированными с каждой кладой (9, 15–19). Более того, археологические исследования показывают свидетельства одомашнивания риса в долине Янцзы, начавшегося ∼8000–9000 лет назад (2–4, 28), а также раннего (и предположительно отдельного) выращивания риса в Ганге в Индии, начавшегося ∼4000 лет назад ( 3).

Недавнее происхождение одомашненных видов сельскохозяйственных культур (<10 000 лет) увеличивает вероятность того, что предковые полиморфизмы сохранятся в одомашненных таксонах из-за неполной сортировки по родословным, что приводит к сходству последовательностей, которое не обязательно отражает взаимосвязи видов и популяций (29, 30).Исследования с использованием моделирования показали, что конкатенация данных может порождать вводящие в заблуждение филогенетические отношения, поскольку игнорирует различные истории эволюции отдельных локусов (31). Действительно, неполная сортировка по клонам приводит к неконгруэнтным генетическим деревьям, когда несколько локусов анализируются независимо, что недавно было показано в роде Oryza (32, 33), но филогенетические исследования риса все еще в значительной степени полагались на конкатенацию данных по нескольким локусам в предположении что преобладающая филогенетическая информация, присущая данным, затмит любой противоречивый сигнал (9, 15, 17–19).

Конфликтующие генные деревья из-за сливающейся стохастичности были проблемой для определения границ видов, но статистические методы, сочетающие популяционную генетику с филогенетикой, теперь позволяют более точно делать выводы о недавней эволюционной истории (см. Ссылку 30). Филогенетический анализ с использованием мультивидового слияния (MSC) способен обнаруживать сигналы дифференциации видов еще до того, как их генные деревья становятся реципрокно монофилетическими (29, 30, 34, 35).

В этом исследовании мы приводим доказательства однократного одомашнивания риса.Мы идентифицировали SNP путем прямого пересеквенирования последовательности> 250 т.п.н. из 630 фрагментов генов в трех хромосомах риса в образцах дикого и культивируемого риса. Затем мы используем два метода, чтобы сделать вывод об эволюционной истории одомашненного азиатского риса: диффузионный подход к демографическому моделированию на основе данных SNP (36) и байесовский эволюционный подход к филогенетическому анализу, реализующий слияние нескольких видов (35) с использованием ранее опубликованных филогенетических данных. наборы данных. Оба подхода поддерживают единственное происхождение риса, и мы также можем оценить дату одомашнивания риса в соответствии с ранее опубликованными археологическими исследованиями.

Результаты

Выборочное сканирование трех хромосом риса.

Мы повторно секвенировали части 630 генов на 8, 10 и 12 хромосомах риса с интервалами ∼100 т.п.н. в множественных образцах (Таблица S1) O. sativa indica ( n = 20) и тропического japonica ( n = 16), а также O. rufipogon ( n = 20) и единичный образец O. nivara , O. barthii и O. meridionalis (данные можно загрузить с http: // puruggananlab.bio.nyu.edu/Rice_data/). Мы получили 255,9 ± 2,09 т.п.н. данных о последовательностях для каждого образца. Всего было идентифицировано 2800 SNP в indica , 2070 SNP в тропическом japonica и 7274 SNP в O. rufipogon . Как и ожидалось, среднее нуклеотидное разнообразие молчащих сайтов (π) было ниже у O. sativa (π = 0,0037 для indica и 0,0028 для тропического japonica ) по сравнению с O. rufipogon (π = 0,0079) во всех регионах. три хромосомы.

Классификация образцов была подтверждена на основании результатов стратификационного анализа популяции STRUCTURE (37) (рис. S1). Эти результаты предполагают, что в нашей выборке было четыре предковых популяции ( K = 4), что соответствует O. sativa ssp. indica , O. sativa ssp. тропическая японская и два кластера O. rufipogon . Однако была лишь незначительная разница в значениях правдоподобия между K = 3 и K = 4, что связано с расщеплением O.rufipogon на две субпопуляции.

Мы использовали данные сканирования хромосом, чтобы сначала идентифицировать предполагаемые избирательные зачистки, области генома, которые показывают доказательства недавнего положительного отбора, на всех трех хромосомах, чтобы мы могли исключить их в наших последующих демографических анализах происхождения риса (см. Ниже). Мы применили два разных метода, чтобы идентифицировать регионы с генетической подписью селективного охвата внутри и между одомашненными видами; они были основаны на ( i ) локальном сокращении нуклеотидного разнообразия и ( ii ) паттернах частотного спектра многопопуляционных аллелей (AFS; материалы и методы и SI Text ).Мы определили в общей сложности 20 областей в трех хромосомах, которые имели доказательства выборочного сканирования по крайней мере в одном из этих тестов. Мы обнаружили, что регионы с пониженным разнообразием были широко распространены как в indica , так и, в частности, в тропическом japonica (рис. 2, рис. S2 и таблица S2), что согласуется с ожиданием сильного искусственного отбора во время одомашнивания риса. Мы также смогли найти предполагаемые выборочные развертки, которые были характерны для индика или тропической японской , а также для регионов с охватом, характерным для обеих групп сортов (рис.2 и рис. S3).

Рис. 2.

Сводка результатов выборочного отображения развертки. Кандидаты в избирательные области развертки, идентифицированные в каждом тесте для отбора для ( A ) хромосомы 8, ( B ) хромосомы 10 и ( C ) хромосомы 12. Результаты для различных подвидов обозначены красным цветом для индика и синим для тропических растений japonica . CLR, тест комплексного отношения правдоподобия, основанный на частотном спектре многопопуляционных аллелей; DIV, тест разнообразия на основе регионов без вариаций; TJ, тропический japonica ; IND.Вертикальные полосы на дорожке CLR соответствуют одиночным фрагментам, поскольку она рассчитывалась для каждого фрагмента отдельно. Цвета на дорожке соответствуют соответствующей популяции, с черными полосами, указывающими на развертку как в indica , так и в тропической japonica . Четыре общих области развертки отмечены точкой.

Демографический вывод.

Мы изучили несколько демографических моделей происхождения и истории выращивания риса в домашних условиях (рис. 1) с использованием подхода, основанного на диффузии, реализованного в программе ∂a∂i (36), которая вычисляет вероятность демографической модели с учетом наблюдаемой многопопуляции. AFS.Мультипопуляционный AFS — это совместное распределение частот аллелей диаллельных вариантов из области генома, секвенированное у нескольких индивидуумов из каждой популяции. Программа ∂a∂i также вычисляет ожидаемую AFS при различных демографических сценариях путем численного решения уравнения диффузии множества популяций, описывающего эффекты мутации, дрейфа и миграции. Вероятность каждой модели может быть вычислена на основе произведения вероятностей Пуассона для каждой записи AFS.

На основании 2057 предположительно нейтральных участков сегрегации ( SI Text ) мы обнаружили, что модели с одним происхождением превосходят модели раздельного одомашнивания индика и тропической японской (таблица 1 и рис.S4). Модель с одним источником обеспечивает лучшее соответствие данным, даже когда предполагаемые области развертки были исключены (таблица 1). Каждая модель имеет одинаковое количество параметров, что делает разницу в 22 единицы логарифмического правдоподобия между моделями с одним и двумя основателями очень значимыми даже после корректировки связи. Однако мы не можем определить, была ли индика или тропическая японская первыми в рамках этих сценариев. Значения параметра максимального правдоподобия, полученные для обеих моделей с одним основателем (с разверткой и без нее), представлены в таблице S3.

Таблица 1.

Модели одомашнивания с одним и двумя основателями и их логарифмическая вероятность с регионами выборочного охвата и без них

Параметры размера популяции и миграции очень похожи во всех моделях, независимо от того, индика или тропическая японская была основана первой. Хотя мы представляем данные для симметричной миграции, мы также протестировали влияние четырех типов миграции на модели, чтобы определить, какой из них лучше всего подходит для AFS (Таблица S4).Эти четыре модели включают симметричную миграцию, асимметричную миграцию, отсутствие миграции из O. rufipogon и полное отсутствие миграции. Мы не устанавливали узкое место для индика и тропическая японская , чтобы упростить пространство параметров при проведении этих сравнений. Модели с асимметричной миграцией подходят немного лучше, но увеличения логарифмической вероятности недостаточно, чтобы оправдать три дополнительных параметра миграции в модели.

Наконец, предыдущее исследование предполагает, что отбор может оказывать влияние на весь геном на частотный спектр сайта (18).Чтобы смоделировать эффекты отбора, мы повторно ранжируем наши демографические модели со слабым положительным отбором (параметр отбора = 1), происходящим во всех популяциях в течение двух- и трехпопуляционных эпох. Мы обнаружили, что даже после запуска моделей со слабым положительным отбором модели с одним основателем по-прежнему превосходят модели с двумя основателями (Таблица S5).

Байесовский повторный анализ ранее опубликованных филогенетических данных.

Поскольку результаты нашего демографического анализа ставят под сомнение общепринятую в настоящее время точку зрения о том, что indica и japonica имеют независимое происхождение, мы исследовали филогению одомашнивания риса.Предыдущие филогенетические исследования объединили данные из нескольких несвязанных локусов — обычная практика, но она оказалась проблематичной при работе с недавними событиями видообразования (30, 31, 35). Байесовский подход, который учитывает неоднородность дерева генов при оценке дерева видов, может обойти эту проблему, и он был реализован в программе * BEAST. К сожалению, наши повторно секвенированные фрагменты генов были слишком короткими (~ 500 п.н.) для * BEAST, чтобы работать хорошо, и вместо этого мы повторно проанализировали ранее опубликованные наборы филогенетических данных, которые использовались для аргументации в пользу независимой одомашнивания indica и japonica (15 –17, 19, 38) (таблица 2).Мы также использовали недавно опубликованный набор данных, в котором изучалась эволюция пути биосинтеза крахмала эндосперма риса (39).

Таблица 2.

Результаты повторного анализа * BEAST ранее опубликованных наборов филогенетических данных

Наш анализ * BEAST двух наборов данных Чжу и Ге (15) и Лондо и др. (16), каждый из которых состоит менее чем из пяти локусов, привел к нескольким двусмысленным топологиям, при этом по крайней мере 90% деревьев в заднем наборе оспаривали монофилию indica и japonica (результаты не показаны).Однако другие четыре набора данных, каждый из которых содержит более пяти локусов, продемонстрировали сильную поддержку единственного происхождения домашнего риса, когда они были повторно проанализированы с использованием * BEAST (таблица 2 и рис. 3). Мы отмечаем, что даже включение O. nivara , который был предложен в качестве альтернативного предкового вида для indica (7, 9), все же выявило более тесную связь между indica и japonica , чем с любым диким рисом. виды (рис. 3). Оба набора данных согласны с тем, что indica и japonica произошли от одного общего предка, даже если все пять групп, включающих азиатский одомашненный рис, представлены в Yu et al.(39) и рассмотрена популяционная структура O. rufipogon (рис. 3).

Рис. 3.

Результаты анализа * BEAST наборов филогенетических данных. Узлы, поддерживаемые с высокой апостериорной вероятностью (≥95%) всеми наборами данных, показаны точкой. I, J, R и N представляют индика , тропический japonica , O. rufipogon и O. nivara соответственно. Цифры над столбиками на графиках указывают процент деревьев в апостериорном распределении вероятностей с заданной топологией или деревьев, которые поддерживают единственное происхождение риса.( A ) Деревья альтернативных видов и их пропорции в апостериорном распределении, полученные в результате анализа Tang et al. (17) (красный) и Zhu et al. (38) (желтый) данные. ( B ) Только одно хорошо укрепленное дерево видов было восстановлено из Rakshit et al. (19) данные. ( C ) Все деревья в заднем распределении, несмотря на включение пяти основных групп сортов [ароматические (Ar), Aus, умеренные japonica (TmJ), тропические japonica (TrJ) и indica (I )] в анализе работы Yu et al.(39), подтверждают единственное происхождение домашних таксонов. Ri и Rc обозначают O. rufipogon из Индии / Индокитая и Китая соответственно.

Применение строгих молекулярных часов из 6,5 × 10 −9 замен на сайт в год для трав (40) привело к оценке среднего времени начала одомашнивания в 8 200 лет до настоящего времени (BP) [95% самая высокая задняя плотность (HPD) = 4 400–12 100 лет назад]. Оценка среднего возраста для раскола Indica и japonica составляет 3900 лет Б.П. (95% HPD = 1,700–6600 лет назад). Оценки возраста выше, когда применялась частота мутаций 3,8 × 10 -9 замен на сайт в год, оцененная по данным сканирования хромосом ( SI Text ). Используя эту частоту молекулярных часов, мы оцениваем расщепление O. sativa от O. rufipogon , начавшееся 13 500 лет назад (95% HPD = 7 400–20 000 лет назад), и двух групп одомашненных сортов риса, разделенных на 6700 лет назад. (95% HPD = 3,700–10,000 лет назад).

Обсуждение

Происхождение азиатского риса долгое время оставалось загадкой для биологов (22, 23), и за последние два десятилетия модель доместикации множественного происхождения, предлагающая независимое одомашнивание индика и тропической японской , имела получили поддержку в основном из молекулярных данных, проанализированных традиционными филогенетическими методами (9, 15–19).Эти филогенетические методы, однако, могут привести к неоднородности предполагаемых топологий генного дерева, особенно среди недавно появившихся видов (30, 33). Эта неоднозначность подтолкнула к разработке альтернативных методов филогенетического вывода, в том числе тех, которые используют слияние многовидовых (30, 35).

Мы переоценили филогению одомашненного риса, используя ранее опубликованные наборы данных, пять из которых использовались для обоснования отдельного происхождения риса индика и тропического риса японика .Наше исследование с теми же данными, повторно проанализированное в рамках многовидовой коалесцирующей структуры, показало сильную поддержку только одного происхождения домашнего риса. Даже включение O. nivara в два набора данных, которые мы проанализировали, все же выявило более тесную связь между indica и тропической japonica , чем с любыми видами дикого риса. Два других набора данных (15, 16) привели к нескольким сомнительным топологиям из-за недостаточного филогенетического сигнала от слишком небольшого количества локусов (<5).Это неудивительно, потому что моделирование показало, что вероятность получения правильного дерева видов увеличивается до 0,75, несмотря на небольшую глубину дерева, когда включены по крайней мере пять локусов (29, 41).

Ранее обнаруженная популяционная структура O. rufipogon (16) нарушает одно из предположений многовидовой модели слияния. Учитывая это при анализе данных Yu et al. (39), однако, по-прежнему показывает indica и japonica как более близкие родственники.Ни один из них не был связан с какой-либо группой дикого риса (индийского / индокитайского или китайского), чего можно было бы ожидать, если бы они были независимо одомашнены. Также, кажется, существует филогенетическая поддержка индийской / индокитайской популяции O. rufipogon как прямой предков одомашненного риса. Однако потребуется более крупная выборка, прежде чем конкретная популяция может быть идентифицирована как предок O. sativa, , а также существует вероятность того, что такая предковая популяция может вымереть.

Вывод о том, что одомашненный рис имеет единственное происхождение, был также подтвержден демографическим моделированием с использованием данных ресеквенирования 630 ядерных локусов из хромосом 8, 10 и 12 риса. искажают наши выводы, потому что эти общие зачистки могут быть связаны с одомашниванием, и одинаковые или очень похожие гаплотипы могут быть зафиксированы в одомашненных разновидностях (либо в результате единственного происхождения, либо в результате параллельной эволюции, либо в результате гибридизации после одомашнивания).Фактически, существует четыре предполагаемых случая общих зачисток на этих трех хромосомах (рис.2), и они сочетаются с известными локусами количественных признаков (QTL) одомашнивания, участвующими в признаках длины метелки, высоты растения, дней до колошения, веса зерна. , и количество зерен (рис. S2). Общие аллели между indica и japonica среди известных генов доместикации также были описаны ранее, в первую очередь, красный околоплодник rc (42), нерасщепляющийся sh5 (25, 43) и архитектура растений prog1 (26 ) места.

Первоначально считалось, что эти и другие общие зачистки возникли в результате интрогрессии между группами сортов в результате постдоместикационной гибридизации (3, 22). Помимо генов доместикации rc , sh5 и prog1 , общие аллели также наблюдались между indica и japonica в генах диверсификации, которые вносят вклад в фенотипическое разнообразие между сортами риса. Эти гены диверсификации включают в себя ген аромата BADh3 (44), ген полукровки sd1 (45), локус устойчивости к болезням Pi-ta (45), ген биосинтеза крахмала Wx (45) и GS3 — ген длины зерен (46).Однако в большинстве этих случаев только небольшая часть разновидностей несет интрогрессированный аллель; это контрастирует с аллелями одомашнивания, общими между indica и japonica , которые находятся на стадии фиксации или близки к ней в обеих группах сортов (25, 26, 42, 43). Действительно, аллели в некоторых из этих локусов диверсификации, по-видимому, были интрогрессированы совсем недавно в результате недавних усилий по селекции (45).

В целом, большинство сортов риса, исследованных с помощью полногеномного анализа SNP, показывают очень низкий уровень доказательств интрогрессии (45).Тем не менее, интрогрессия между japonica и indica может скрыть доказательства множественного происхождения домашнего риса. Эккерт и Карстенс (41), однако, показали, что основанные на объединении методы филогенетического вывода по-прежнему надежны, несмотря на умеренный объем исторического потока генов. Более того, мы находим сильную поддержку единого происхождения в нашем демографическом моделировании, даже когда исключаются предполагаемые регионы выборочного охвата, в том числе те, которые являются общими для групп одомашненного риса.Наконец, наше моделирование учитывало поток / миграцию генов в демографических выводах, и все же предпочтение было отдано модели с одним происхождением. В совокупности наши результаты показывают, что многие из общих селективных перемещений, наблюдаемых среди генов одомашнивания риса (в отличие от локусов диверсификации), возникают не из-за интрогрессии между уже одомашненными индика и японская , а вместо этого отражают единственное происхождение этого вида культивируемых сельскохозяйственных культур. .

Предыдущие исследования оценили время расхождения между indica и japonica примерно на 86–440 тыс. Лет назад (14, 15, 17, 21), задолго до одомашнивания риса.Эти оценки были получены путем применения молекулярных часов к оценкам дивергенции между парами последовательностей из O. sativa ssp. japonica и O. sativa ssp. indica , и предполагаемое время расхождения было интерпретировано как свидетельство того, что они были получены независимо от расходящихся исходных популяций O. rufipogon . Однако такая интерпретация оценок времени расхождения не оправдана, и нет необходимости ссылаться на существование глубоко структурированной исходной популяции для объяснения древнего времени слияния.В случае недавнего расхождения популяций общий предок пары аллелей, выбранных случайным образом из каждой популяции, будет существовать задолго до появления самих популяций. Следовательно, предполагаемое время слияния аллелей indica и japonica может значительно превышать время с момента одомашнивания, даже если аллели были получены от одной популяции панмиктических предшественников. Эта неспособность учитывать наследственные вариации привела к ошибочным выводам в ряде контекстов (47) и, по-видимому, чрезмерно повлияла на представления о происхождении риса.

Если принять во внимание наследственную вариацию при слиянии многовидовых видов, время расхождения между O. sativa и O. rufipogon и между indica и japonica оказывается гораздо более поздним. Точная оценка времени расхождения зависит от того, какую скорость молекулярных часов мы используем. Если мы воспользуемся оценкой скорости нуклеотидных замен в злаках (40), мы найдем время расхождения между O. rufipogon и O.sativa ∼8 200 лет назад и между тропическим japonica и indica ∼3900 лет назад. Если мы применим скорость молекулярных часов, оцененную по данным сканирования хромосом ( SI Text ), мы получим более раннюю среднюю дату одомашнивания риса (13 500 лет назад). Первые молекулярные оценки прекрасно согласуются с археологическими оценками начала одомашнивания риса в долине Янцзы (∼8000–9000 лет назад) и распространения риса индика в Южной Азии (∼4000 лет назад) (3, 28 ), и даже последняя дата все еще попадает в верхнюю границу оценок археологического датирования фитолитов риса, собранных в нижнем течении Янцзы (4).

Хотя наш анализ согласуется с одним происхождением риса, одна возможность состоит в том, что и indica , и japonica произошли от высокодифференцированных генофондов O. rufipogon , образцы которых не были исследованы ни нами, ни другими ранее опубликованными филогенетическими исследователями. исследования. Мы думаем, что это маловероятно, потому что для получения наших результатов оба этих генофонда (один для Indica и другой для japonica ) не должны быть представлены в нашей выборке.Более того, если бы эти генофонды существовали, они отделились бы друг от друга примерно во время одомашнивания риса, чтобы соответствовать нашим оценкам времени разделения индика / японика .

Археологические исследования были интерпретированы как подтверждающие филогенетические доказательства множественного происхождения риса. Два центра одомашнивания риса — долина реки Янцзы в Китае и Ганг в Индии — были идентифицированы на основании обнаружения нерушимых оснований рисовых колосков в археологических памятниках этих регионов (3).Древнейшие археологические свидетельства одомашнивания риса происходят из долины Янцзы, где japonica или japonica -подобный одомашненный рис, по-видимому, присутствовали еще ∼8000–9000 лет назад (2–4, 28). Приручение риса в Ганге также наблюдалось, но рис здесь, кажется, является второстепенной культурой (или был собран диким), и его значение существенно выросло только примерно через 4000 лет после одомашнивания риса в долине Янцзы (3).

Было высказано предположение, что древние народы, возможно, принесли japonica на запад по Шелковому пути с другими культурами, такими как просо, абрикосы и персики (3).Гибридизация этого сорта japonica с местными сортами прото- indica наряду с активным отбором могла быстро привести к появлению и распространению современного вида O. sativa ssp. индика (3). Другие модели предполагают гибридизацию одного одомашненного с локально дифференцированными популяциями O. rufipogon , что привело к современным indica и тропическим japonica (48, 49). Хотя они различаются в деталях, эти модели согласуются с единственным происхождением одомашненного риса в долине Янцзы с последующим распространением и гибридизацией этого исходного одомашненного растения, что в конечном итоге привело к появлению индика (48).

Вопрос о происхождении одомашненного риса (или любого одомашненного вида) представляет собой сложную проблему, поскольку деятельность человека могла привести к размыванию генетических сигнатур, что затрудняет попытки реконструировать эволюционную историю этих недавних видов, ассоциированных с человеком. Демографические факторы, такие как безудержная примесь, усугубляемая эффектами длительного узкого места в процессе одомашнивания, могут скрыть генетические доказательства моделей одомашнивания, в том числе те, которые указывают на множественное происхождение культивируемых видов (50).Однако из нашего исследования ясно, что неполная сортировка по происхождению во время процесса слияния может объяснить предыдущие филогенетические выводы о множественном происхождении риса. По мере того, как становится доступным все больше данных по всему геному, было бы интересно посмотреть, поддерживаются ли результаты нашего анализа этими методами реконструкции эволюционной истории и демографических процессов, связанных с недавними видообразованиями, характерными для одомашнивания.

Несколько других одомашненных таксонов из-за выраженной внутривидовой фенотипической или генетической дифференциации также, по-видимому, имеют множественное эволюционное происхождение.Было показано, что ячмень (51), виноград (52) и тыквенные (53), а также виды домашнего скота, такие как овцы (54) и крупный рогатый скот (55), возникали более одного раза, что указывает на то, что разные культуры заново изобрели эти одомашненные видов несколько раз, вместо того, чтобы получать их путем распространения из других сельскохозяйственных сообществ. Рис также считался ярким примером одомашненных видов с множественным происхождением (9, 15–19), предполагая, что неолитические культуры Китая и Индии по отдельности привели к одомашниванию этого вида зерновых культур.Однако теперь кажется, что рис, возможно, возник только в одном географическом регионе Азии, и что, исходя из этого единственного происхождения, мы теперь находим пищевые виды с широким географическим и культурным охватом, что привело к тому, что он стал основной продовольственной культурой для большая часть населения мира.

Материалы и методы

Ресеквенирование фрагментов генов на трех хромосомах риса.

Наша панель повторного секвенирования состояла из 20 образцов O. rufipogon , 36 образцов староместного сорта O.sativa (20 indica и 16 тропических растений japonica ) и по одному из O. nivara , O. meridionalis и O. barthii , полученных от Международного научно-исследовательского института риса и Министерства сельского хозяйства США. (Таблица S1). ДНК была извлечена, и фрагменты генов размером ~ 500 п.н. из генов, кодирующих белок, расположенных с интервалами ~ 100 т.п.н. на хромосомах 8, 10 и 12, были повторно секвенированы. Подробности секвенирования, структуры популяции и анализа разнообразия приведены в SI Text .

Отображение выборочной развертки.

Мы использовали два разных метода для составления карты выборочных обследований, связанных с одомашниванием риса из O. rufipogon на основе локального сокращения разнообразия, а также многопопуляционного AFS, используемого в демографическом заключении. Подробная информация об этих анализах содержится в SI Text .

Демографический вывод.

Мы протестировали различные модели с одним и двумя источниками происхождения (рис. 1), используя ∂a∂i (36) (исходный код доступен по запросу). Модели с одним происхождением состояли из демографических сценариев indica из japonica или japonica из indica (рис.1). Модели с двойным происхождением можно разделить на Indica first или japonica first serial базовых моделей, и они постулируют, что каждое домашнее животное возникло независимо друг от друга (рис. 1). Мы включили узкие места во все наши модели для создания популяций Indica и тропических растений japonica . Подробности моделирования можно найти в SI Text .

* BEAST Анализ опубликованных наборов данных последовательностей риса.

Используя программу «Реконструкция предков деревьев видов / байесовский эволюционный анализ по деревьям» (* BEAST v1.6.1) (35), мы повторно проанализировали шесть ранее опубликованных наборов филогенетических данных (15–17, 19, 38, 39). Следует отметить, что исследование Tang et al. (17) выбрали в своем анализе нетипичные, сильно расходящиеся локусы. Более того, набор данных Yu et al. (39), включенный в наш анализ, содержит возможные выбранные локусы, но ни один из этих локусов не демонстрирует селективные развертки, общие для indica и japonica .MrModeltest (56) был запущен на каждом локусе, чтобы определить наиболее подходящие модели эволюции нуклеотидов. Для дерева видов был указан приор Йоль, который предполагает, что линии разделились с постоянной скоростью (57). Каждый набор данных был проанализирован независимо в * BEAST с использованием строгих молекулярных часов для эталонного локуса на основе средней нейтральной скорости замены для трав (0,0065 замен / сайт на миллион лет) (46), на основании которой была оценена скорость других генов. Другие подробности филогенетического анализа можно найти в SI Text .

Благодарности

Авторы хотели бы поблагодарить Дориана Фуллера, Эндрю Дуста и Джозефа Хеледа за полезные обсуждения, Криса Смита за помощь в разработке конвейера контроля качества SNP и Xianfa Xie за помощь в выборе некоторых образцов. Мы также хотели бы поблагодарить Денниса Виджаджа, Келли Клемензу, Наэху Бхамбру, Ханну Чаудри и Сильвию Джерард-Мартинес за помощь в обработке данных о последовательностях. Эта работа частично финансировалась Программой исследования генома растений Национального научного фонда.

Сноски

  • Вклад авторов: J.M., J.M.F., S.J., B.A.S., C.D.B., A.R.B. и M.D.P. спланированное исследование; J.M., J.M.F., S.R. и P.H. проведенное исследование; A.R., P.H. и B.A.S. внесены новые реагенты / аналитические инструменты; J.M., M.S., N.G., J.M.F., C.D.B. и A.R.B. проанализированные данные; и J.M., M.S., N.G., B.A.S., A.R.B. и M.D.P. написал газету.

  • Авторы заявляют об отсутствии конфликта интересов.

  • Размещение данных: из-за сложности данных в виде множественных выравниваний последовательностей нет общедоступной базы данных, которая могла бы приспособить этот формат.Поэтому мы делаем данные доступными в виде заархивированного файла на http://puruggananlab.bio.nyu.edu/Rice_data/, как указано в Результатах .

  • Эта статья содержит вспомогательную информацию на сайте www.pnas.org/lookup/suppl/doi:10.1073/pnas.1104686108/-/DCSupplemental.

4.6: Молекулярные доказательства — K12 LibreTexts

Насколько вы похожи на шимпанзе?

Шимпанзе и люди оказываются очень похожими, если посмотреть на их ДНК.Когда ученые определили весь генетический код людей и шимпанзе, они обнаружили, что у нас более 98% идентичной ДНК.

Молекулярные доказательства

Возможно, одни из лучших свидетельств эволюции получены при изучении молекул и ДНК, обнаруженных во всех живых существах.

Начиная с 1940-х годов, ученые, изучающие молекулы и ДНК, подтвердили выводы об эволюции, сделанные на основе других форм свидетельств. Молекулярные часы используются для определения степени родства двух видов путем вычисления количества различий между последовательностями ДНК или аминокислотными последовательностями видов.Эти часы иногда называют генными часами или эволюционными часами. Чем меньше различий, тем меньше времени прошло с тех пор, как виды отделились друг от друга и начали эволюционировать в разные виды (рисунок ниже).

У курицы и гориллы будет больше различий между их ДНК и аминокислотными последовательностями, чем у гориллы и орангутана. Это означает, что курица и горилла имели общего предка очень давно, в то время как горилла и орангутанг имели общего более позднего общего предка.Это является дополнительным свидетельством того, что горилла и орангутанг более тесно связаны между собой, чем горилла и курица. Какая пара организмов будет иметь больше молекулярных различий: млекопитающее и птица, млекопитающее и лягушка или млекопитающее и рыба?

С другой стороны, животные могут выглядеть одинаково, но иметь очень разные последовательности ДНК и эволюционное происхождение. Что может иметь больше общих последовательностей ДНК: кит и лошадь или кит и акула?

Рисунок \ (\ PageIndex {1} \): Почти все организмы состоят из ДНК с одинаковыми строительными блоками.Геномы (все гены в организме) всех млекопитающих почти идентичны.

геномов , или все последовательности ДНК всех генов организма, были определены для многих различных организмов. Сравнение геномов дает новую информацию о взаимоотношениях между видами и о том, как происходит эволюция (рисунок ниже).

Молекулярные доказательства эволюции также включают:

  1. Одни и те же биохимические строительные блоки, такие как аминокислоты и нуклеотиды, присутствуют во всех организмах, от бактерий до растений и животных.Напомним, что аминокислоты являются строительными блоками белков, а нуклеотиды — строительными блоками ДНК и РНК.
  2. ДНК и РНК определяют развитие всех организмов.
  3. Сходства и различия между геномами подтверждают закономерности эволюции.
Рисунок \ (\ PageIndex {2} \): Это карта генов только на одной из 46 хромосом человека. Как этот участок хромосомы сравнивается с аналогичными участками у других видов? Сходства и различия между геномами (генетический состав) разных организмов раскрывают отношения между видами.

Сводка

  • Молекулярные часы используются для определения степени родства двух видов путем вычисления количества различий между последовательностями ДНК или аминокислотными последовательностями видов.
  • Молекулярные доказательства эволюции включают в себя то, что все живые существа имеют одни и те же биохимические строительные блоки.

Узнать больше

Используйте указанные ниже ресурсы, чтобы ответить на следующие вопросы.

Узнать больше I

  • Гены говорят нам об эволюции — Форма жизни

  1. Как генетическая последовательность организма похожа на план этого организма?
  2. Если два организма имеют почти идентичные последовательности одного и того же гена, считаются ли они близкородственными?
  3. Какой тип животного, по мнению ученых, был основным по отношению ко всем остальным животным? Как генетический анализ повлиял на эту точку зрения?
  4. Как генетический анализ стал быстрее, чем был раньше? Как это сильно помогло в поисках основного организма?

Узнать больше II

  • Как гены прямого развития — Форма жизни

  1. Что такое регуляторный ген? Как они могут объяснить различия между организмами?
  2. Что такое «гены hox»? На каком этапе развития они находятся? У каких организмов есть hox-гены?
  3. Если вы обнаружите муху с выходящей из головы ногой и сможете определить, что произошло генетически, чтобы вызвать это, что вы обнаружили?

Обзор

  1. Объясните, как ученые используют молекулярные часы для определения взаимоотношений между видами.
  2. Что такое геном?
  3. Какие два вида из следующего должны иметь наименьшее количество различий в геномах: курица, мышь, утка, горилла?
  4. Какие два вида из следующего должны иметь наибольшие различия в геномах: лягушка, мышь, корова, человек?

Глобальные закономерности диверсификации насекомых: к примирению ископаемых и молекулярных свидетельств?

  • Лабандейра К. и Сепкоски Дж.J. Разнообразие насекомых в летописи окаменелостей. Science 261, 310–315 (1993).

    CAS Статья ОБЪЯВЛЕНИЯ PubMed Google ученый

  • Футтит Р. Г. и Адлер П. Х. Биоразнообразие насекомых: наука и общество (Blackwell Publishing Ltd., 2009).

  • Гримальди Д. и Энгель М. С. Эволюция насекомых (Cambridge University Press, 2005).

  • Лабандейра, К. К. Летопись окаменелостей вымирания насекомых: новые подходы и направления на будущее.Являюсь. Энтомолог 51, 14–29 (2005).

    Артикул Google ученый

  • Мэйхью, П. Дж. Почему существует так много видов насекомых? Перспективы окаменелостей и филогении. Биол. Ред. 82, 425–454 (2007).

    Артикул PubMed Google ученый

  • Фаррелл Б. Д. Объяснение «чрезмерной привязанности»: Почему так много жуков? Science 281, 555–559 (1998).

    CAS Статья PubMed Google ученый

  • Моро, К.С., Белл, К. Д., Вила, Р., Арчибальд, С. Б. и Пирс Н. П. Филогения муравьев: диверсификация в возрасте покрытосеменных. Science 312, 101–104 (2006).

    CAS Статья ОБЪЯВЛЕНИЯ PubMed Google ученый

  • Hunt, T. et al. Всесторонняя филогения жуков раскрывает эволюционное происхождение сверхизлучения. Science 318, 1913–1916 (2007).

    CAS Статья ОБЪЯВЛЕНИЯ PubMed Google ученый

  • Маккенна, Д., Секейра, А. С., Марвальди, А. Э. и Фаррелл, Б. Д. Временные лагы и перекрытие в диверсификации долгоносиков и цветковых растений. Proc. Natl. Акад. Sci. USA 106, 7083–7088 (2009).

    CAS Статья ОБЪЯВЛЕНИЯ PubMed Google ученый

  • Вигманн, Б. М. и др. Эпизодические излучения в древе жизни мух. Proc. Natl. Акад. Sci. USA 108, 5690–5695 (2011).

    CAS Статья ОБЪЯВЛЕНИЯ PubMed Google ученый

  • Уолберг, Н., Пшеница, К. В. и Пенья, С. Сроки и закономерности таксономической диверсификации чешуекрылых (бабочки и мотыльки). PLoS One 8, e80875 (2013).

    Артикул ОБЪЯВЛЕНИЯ CAS PubMed PubMed Central Google ученый

  • Аренс Д., Шварцер Дж. И Фоглер А. П. Эволюция жуков-скарабеев отслеживает последовательный рост покрытосеменных и млекопитающих. Proc. R. Soc. В 281, 20141470 (2014).

  • Кергоат, Г.J. et al. Изменения окружающей среды в меловом периоде привели к высокой текучести и снижению темпов диверсификации в сверхразнообразном семействе нефитофагов. BMC Evol. Биол. 14, 220 (2014).

    Артикул PubMed PubMed Central Google ученый

  • McKenna, D. D. et al. Древо жизни жуков показывает, что жесткокрылые пережили массовое вымирание в конце перми, чтобы разнообразить свой вид во время земной революции мелового периода. Syst. Энтомол.40, 835–880 (2015).

    Артикул Google ученый

  • Лабандейра, К. К., Джонсон, К. Р. и Уилф, П. Влияние последнего мелового периода на ассоциации растений и насекомых. Proc. Natl. Акад. Sci. СОЕДИНЕННЫЕ ШТАТЫ АМЕРИКИ. 99, 2061–2066 (2002).

    CAS Статья ОБЪЯВЛЕНИЯ PubMed Google ученый

  • Бентон, М. Дж. Истоки современного биоразнообразия на суше. Фил. Пер.R. Soc. B 365, 3667–3679 (2010).

    Артикул PubMed Google ученый

  • Ллойд, Г. Т. и др. Динозавры и земная революция мелового периода. Proc. R. Soc. B 275, 2483–2490 (2008).

    Артикул PubMed Google ученый

  • Хванг, В. С. и Вейраух К. История эволюции клопов-убийц (Insecta: Hemiptera: Reduviidae): выводы из датировок расхождений и реконструкции состояния предков.PLoS One 7, e45523 (2012).

    CAS Статья ОБЪЯВЛЕНИЯ PubMed PubMed Central Google ученый

  • Кардинал, С. и Данфорт, Б. Н. Разнообразие пчел в эпоху эвдикотов. Proc. R. Soc. В 280, 20122686 (2013).

    Артикул PubMed Google ученый

  • Song, H. et al. 300 миллионов лет диверсификации: выяснение закономерностей эволюции прямокрылых на основе всестороннего отбора таксонов и генов.Кладистика. org / 10.1111 / cla.12116 (2015).

  • Zhu, Q., Hastriter, M. W., Whiting, M. F. & Dittmar, K. Блохи (Siphonaptera) относятся к меловому периоду и эволюционировали вместе с Theria. Мол. Филогенет. Evol. 2015. Т. 90. С. 129–139.

    Артикул PubMed Google ученый

  • Ким С. И. и Фаррелл Б. Д. Филогения мировых жуков-оленей (Coleoptera: Lucanidae) раскрывает гондванское происхождение жука-оленя Дарвина. Мол. Филогенет.Evol. 86, 35–48 (2015).

    Артикул PubMed Google ученый

  • Лабандейра, К. К., Дилчер, Д. Л., Дэвис, Д. Р. и Вагнер, Д. Л. Девяносто семь миллионов лет ассоциации покрытосеменных и насекомых: палеобиологическое понимание значения коэволюции. Proc. Natl. Акад. Sci. USA 91, 12278–12282 (1994).

    CAS Статья ОБЪЯВЛЕНИЯ PubMed Google ученый

  • Николсон, Д.Б., Росс, А. Дж. И Мэйхью, П. Дж. Ископаемые свидетельства ключевых инноваций в эволюции разнообразия насекомых. Proc. R. Soc. В 281, 20141823 (2014).

    Артикул Google ученый

  • Сон, Ж.-К., Лабандейра, К. и Дональд, Д. Р. Летопись окаменелостей и тафономия бабочек и моли (Insecta, Lepidoptera): значение для эволюционного разнообразия и оценок времени расхождения. BMC Evol. Биол. 15, 12 (2015).

    Артикул PubMed PubMed Central Google ученый

  • Рейнфорд, Дж.Л., Хофрейтер, М., Николсон, Д. Б. и Мэйхью, П. Дж. Филогенетическое распределение сохранившихся богатств предполагает, что метаморфозы являются ключевой инновацией, способствующей диверсификации насекомых. PLoS One 9, e109085 (2014).

    Артикул ОБЪЯВЛЕНИЯ CAS PubMed PubMed Central Google ученый

  • Alfaro, M. E. et al. Девять исключительных излучений плюс высокий оборот объясняют видовое разнообразие челюстных позвоночных. Proc. Natl. Акад. Sci.USA 106, 13410–13414 (2009).

    CAS Статья ОБЪЯВЛЕНИЯ PubMed Google ученый

  • Дэвис, Р. Б., Николсон, Д. Б., Сондерс, Э. Л. и Мэйхью, П. Дж. Пробелы в ископаемых, выведенные из филогении, изменяют очевидную природу разнообразия стрекоз и их родственников. BMC Evol. Биол. 11, 252 (2011).

    Артикул PubMed PubMed Central Google ученый

  • Сильвестро, Д., Шницлер, Дж., Лиоу, Л. Х., Антонелли, А. и Саламин, Н. Байесовская оценка видообразования и исчезновения на основе неполных данных о встречаемости окаменелостей. Syst. Биол. 63. С. 349–367 (2014).

    Артикул PubMed PubMed Central Google ученый

  • Сильвестро, Д., Саламин, Н. и Шницлер, Дж. Пайрейт: новая программа для оценки скорости видообразования и вымирания по неполной летописи окаменелостей. Методы экол. Evol. 5. С. 1126–1131 (2014).

    Артикул Google ученый

  • Stadler, T. Филогения млекопитающих обнаруживает недавние сдвиги в темпах диверсификации. Proc. Natl. Акад. Sci. USA 108, 6187–6192 (2011).

    CAS Статья ОБЪЯВЛЕНИЯ PubMed Google ученый

  • Rabosky, D. L. Автоматическое определение ключевых инноваций, сдвигов темпов и зависимости разнообразия на филогенетических деревьях. PLoS One 9, e89543 (2014).

    Артикул ОБЪЯВЛЕНИЯ CAS PubMed PubMed Central Google ученый

  • Renne P. R. et al. Временные масштабы критических событий на границе мела и палеогена. Science 339, 684–687 (2013).

    CAS Статья ОБЪЯВЛЕНИЯ PubMed Google ученый

  • Liu, Z. et al. Глобальное похолодание во время перехода климата от эоцена к олигоцену. Science 323, 1187–1190 (2009).

    CAS Статья ОБЪЯВЛЕНИЯ Google ученый

  • Нг, Дж. И Смит, С. Д. Как черты формируют деревья: новые подходы к обнаружению диверсификации родословной, зависящей от состояния персонажа. J. Evol. Биол. 27, 2035–2045 (2014).

    CAS Статья PubMed Google ученый

  • Rabosky, D. L. & Goldberg, E. E. Неадекватность модели и ошибочные выводы о видо-зависимом видообразовании.Syst. Биол. 2015. Т. 64. С. 340–355.

    CAS Статья PubMed Google ученый

  • Николсон, Д. Б., Мэйхью, П. Дж. И Росс А. Дж. Изменения в летописи окаменелостей насекомых за пятнадцать лет открытий. PLoS One 10, e0128554 (2015).

    Артикул CAS PubMed PubMed Central Google ученый

  • Дэвис, Р. Б., Балдауф, С. Л. и Мэйхью, П.J. Многие группы гексапод возникли раньше и противостояли событиям вымирания лучше, чем предполагалось ранее: выводы из супердеревьев. Proc Biol Sci. B 277, 1597–1606 (2010).

    Артикул Google ученый

  • Смит Д. М. и Маркот Дж. Д. Летопись окаменелостей и макроэволюционная история жуков. Proc. R. Soc. В 282, 20150060 (2015).

    Артикул PubMed Google ученый

  • Рабовский, Д.Л. и Ловетт, И. Дж. Взрывное эволюционное излучение: уменьшение видообразования или усиление вымирания со временем? Evolution 62, 1866–1875 (2008).

    Артикул PubMed Google ученый

  • Моен, Д. и Морлон, Х. Почему замедляется диверсификация? Trends Ecol. Evol. 29. С. 190–197 (2014).

    Артикул PubMed Google ученый

  • Фаррелл, Б.Д. и Секейра, А. С. Темпы эволюции адаптивной радиации жуков на растениях. Evolution 58, 1984–2001 (2004).

    PubMed Google ученый

  • Коннер, У. Э. и Коркоран, А. Дж. Звуковые стратегии: 65-миллионная битва между летучими мышами и насекомыми. Анну. Преподобный Энтомол. 57, 21–39 (2012).

    CAS Статья PubMed Google ученый

  • Лабандейра, К.К. и Куррано, Э. Д. Летопись окаменелостей динамики растений и насекомых. Анну. Преподобный «Планета Земля». Sci. 41, 287–311 (2013).

    CAS Статья ОБЪЯВЛЕНИЯ Google ученый

  • Peñalver, E. et al. Длиннохоботковые мухи как опылители голосеменных меловых растений. Curr. Биол. 25, 1917–1923 (2015).

    Артикул CAS PubMed Google ученый

  • Морлон, Х., Парсонс, Т.Л. и Плоткин, Дж. Согласование молекулярной филогении с летописью окаменелостей. Proc. Natl Acad. Sci. USA 108, 16327–16332 (2011).

    CAS Статья ОБЪЯВЛЕНИЯ PubMed Google ученый

  • Мэй, М. Р. и Мур, Б. Р. Насколько хорошо мы можем обнаружить сдвиги в темпах диверсификации родословной? Имитационное исследование последовательных методов AIC. bioRxiv doi.org/10.1101/011452 (2015).

  • Morlon, H. Филогенетические подходы к изучению диверсификации Ecol.Lett. 17. С. 508–525 (2014).

    Артикул PubMed Google ученый

  • Rabosky, D. L. et al. Темпы видообразования и морфологической эволюции коррелируют по самой большой радиации позвоночных. Nature Commun. 4, 1958 (2013).

    Артикул ОБЪЯВЛЕНИЯ CAS Google ученый

  • Рабоски Д. Л., Доннеллан С. К., Грундлер М. и Ловетт И. Дж. Анализ и визуализация сложной макроэволюционной динамики: пример из австралийских сцинтилевых ящериц.Syst. Биол. 63, 610–627 (2014).

    Артикул PubMed Google ученый

  • Рабоски, Д. Л., Грундлер, М., Андерсон, К., Ши Дж. Дж., Браун, Дж. У., Хуанг, Х. и Ларсон, Дж. Г. BAMMtools: пакет R для анализа эволюционной динамики на филогенетических деревьях. Методы экол. Evol. 5. С. 701–707 (2014).

    Артикул Google ученый

  • Кавано, Дж. Э.Объединение производных Акаике и исправленных информационных критериев Акаике. Стат. Вероятно. Lett. 31, 201–208 (1997).

    Артикул MathSciNet МАТЕМАТИКА Google ученый

  • Касс, Р. Э. и Рафтери, А. Э. Байесовские факторы. Варенье. Стат. Доц. 90, 773–795 (1995).

    Артикул MathSciNet МАТЕМАТИКА Google ученый

  • Рауп Д. М. Ошибки в летописи окаменелостей видов и родов.Бык. Карнеги Мус. Nat. Hist. 13, 85–91 (1979).

    Google ученый

  • Сильвестро Д., Каскалес-Минана Б., Бэкон К. Д. и Антонелли А. Возвращение к происхождению и разнообразию сосудистых растений посредством всестороннего байесовского анализа летописи окаменелостей. Новый Фитол. 2015. Т. 207. С. 425–436.

    Артикул PubMed PubMed Central Google ученый

  • Молекулярные доказательства эволюции ихновирусов из асковирусов путем симбиогенеза | BMC Ecology and Evolution

    DpAV4 и родственные ихновирусу белки

    Геном DpAV4, секвенированный Genoscope (Франция), имеет длину 119 334 п.н.Его организация, генное содержание и эволюционные характеристики будут подробно описаны в отдельной публикации (рукопись в стадии подготовки; дополнительный файл 1). Однако результаты BLAST, полученные с несколькими ORF в геноме DpAV4, свидетельствуют о том, что некоторые ORF ихновирусов имеют своих ближайших родственников в геноме асковирусов. В частности, мы идентифицировали область размером 13 т.п.н., которая содержит кластер из трех генов (рис. 1, ORF90, 91 и 93; дополнительные файлы 1 и 2), которые имеют близкие гомологи в семействе генов GfIV, состоящем из семи членов [28].Все они содержат домен, аналогичный консервативному домену, обнаруженному в семействе NTPases pox-D5. На сегодняшний день этот домен pox-D5 был идентифицирован как NTP-связывающий домен из примерно 250 аминокислотных остатков, обнаруженных только в вирусных белках, кодируемых геномами поксвируса, иридовируса, асковируса и мимивируса. Эти гены кажутся специфичными для GfIV, поскольку они отсутствуют в трех секвенированных геномах других ихновирусов, а именно CsIV, Tranosema rostrales, ichnovirus (TrIV) и Hyposoter fugitivus, ichnovirus (HfIV).

    Рисунок 1

    Карта области 13 kbp генома DpAV4 (EMBL Acc. N ° CU469068 и CU467486) , которая содержит кластер генов с прямыми гомологами в геноме Granifeae ихновирус. ORF DpAV-4 с хорошо охарактеризованными прямыми гомологами среди геномов других асковирусов и иридовирусов показаны белыми стрелками. Гомологичная ORF генов GfIV представлена ​​черными стрелками. Последовательность и особенности белка, кодируемого этими ORF, подробно описаны на рис.S1. Ниже график масштабирован в кбит / с.

    Более конкретно, в DpAV4 ORF90 кодирует белок из 925 аминокислотных остатков, который на 40% похож в положениях от 140 до 925, с белком из 972 аминокислотных остатков, кодируемым ORF1, содержащимся в сегменте C20 в геноме GfIV (рис. . 2). Таким образом, эти два белка можно считать предполагаемыми ортологами. 480 C-концевых остатков этого белка DpAV4 также на 42% аналогичны C-концевому домену гомологов белка, кодируемого ORF1 сегментов D1 и D4 GfIV, на 36% аналогичны N-концевому и C-концевому участкам. домены белка, кодируемого ORF 184R и 128L иридовируса CIV и LCDV, и на 30% сходны с теми, которые кодируются ORF 119, 99 и 78 в геномах асковирусов HvAV3e, SfAV1a и TnAV2c, соответственно.В целом это указывает на то, что этот белок DpAV4 более тесно связан с белком GfIV, чем с белками, обнаруженными в других геномах асковирусов и иридовирусов, доступных в настоящее время в базах данных. ORF091 кодирует белок из 161 аминокислотного остатка, подобный только C-концевому домену трех белков, кодируемых ORF 1, 1 и 3, содержащихся, соответственно, в сегментах D1, D4 и D3 GfIV. Напротив, ORF93 ближе к генам иридовируса и асковируса, чем к генам GfIV. Этот белок, состоящий из 849 аминокислотных остатков, на 43% подобен по всей своей длине ортологам CIV ORF184R во всех иридовирусных и асковирусных геномах и только на 36% подобен более чем 350 аминокислотным остаткам С-концевому домену гомологов белка GfIV, кодируемых ORF1, 2, 1, 1, 1 и 1 в сегментах C20, C21, D1, D2, D3 и D4 этого вируса соответственно.

    Рисунок 2

    Сравнение аминокислотных последовательностей в результате поиска BLAST, выполненного с использованием ORF90 DpAV4 в качестве запроса, и наилучшее совпадение, соответствующее белку, кодируемому ORF1 сегмента ихновируса GfV-C20 (Субъект; Genbank Acc № YP_001029423).

    Анализ генов, окружающих кластер ORF-90-91-93 DpAV4, подтверждает, что этот вирус имеет асковирусное происхождение, поскольку эта область содержит ORF, которые являются близкими гомологами генов в геномах иридовирусов и асковирусов.Выше кластера ORF-90-91-93 присутствует ORF, кодирующая субъединицу C ДНК-зависимой РНК-полимеразы 1, которая является ортологом ORF176R иридовируса CIV и ORF008 асковируса SfAV1a. Ниже этого кластера расположены два гена, которые отсутствуют в известных асковирусных геномах, но аналогичны иридовирусным ORF115L CIV и CIV ORF132L. Эти два гена кодируют, соответственно, белок инициации хромосомной репликации и белок цинкового пальца. Между ними присутствует ген, кодирующий небольшой белок, который подобен гену, кодируемому ORF069L иридовируса CIV, и который соответствует ALI-подобному белку, также обнаруженному в энтомопоксвирусах [30].

    Поскольку три гена DpAV4 имеют родственников во всех секвенированных геномах асковирусов и иридовирусов, их присутствие в геноме DpAV4 не может быть результатом латерального переноса, который произошел от генома ихновируса, связанного с GfIV, на DpAV4. Таким образом, поскольку эти гены DpAV4 являются ближайшими родственниками семейства генов pox-D5, выявленных в GfIV, их можно рассматривать как ориентир симбиогенного асковирусного происхождения линии ихновирусов, к которой принадлежит этот полиднавирус. Альтернативное объяснение состоит в том, что присутствие DpAV4-подобных генов в геноме GfIV является результатом латерального переноса вирусных геномов, тесно связанных с геномами GfIV и DpAV4.Действительно, это могло произойти, когда оса Glypta была инфицирована наследственным вирусом, связанным с DpAV4. Тем не менее, симбиогенное происхождение GfIV из асковирусов также подтверждается морфологическими особенностями его вирионов [28], которые, помимо сходства по форме, также демонстрируют ретикуляции на своей поверхности в отрицательно окрашенных препаратах, что характерно для вирионов всех видов асковирусов. изучены к настоящему времени [7].

    Взаимоотношения между асковирусными и ихновирусными белками вириона

    Поскольку асковирусные вирионы и ихновирусные частицы обладают структурным сходством, мы разработали подход к поиску гомологов структурных белков вирионов в ихновирусах.Эти подходы были начаты в 2000 г. и недавно были доработаны, но некоторые выводы были опубликованы [14]. К настоящему времени охарактеризованы только два белка вириона из ихновируса Campoletis sonorensis (CsIV) [31, 32]. Первый — это P44 (Acc N ° AAD01199), структурный белок, который, по-видимому, расположен в виде слоя между внешней оболочкой и нуклеокапсидом, а второй, P12, капсидный белок (Acc N ° AF004367). В настоящее время в базах данных имеется более ста последовательностей асковирусных или иридовирусных МСР.Поиски BLAST с использованием этих последовательностей не выявили каких-либо сходств между белками вириона CsIV и асковирусными или иридовирусными MCP или любыми другими белками [33]. Чтобы оценить возможность того, что гомология между ихновирусом и белками вириона асковируса может просто не быть обнаружена с помощью обычного поиска Blastp, мы использовали другой метод, WAPAM (взвешенное сопоставление с образцом автоматов; [34]). Модели были разработаны на основе предыдущего исследования [22], демонстрирующего, что MCP, кодируемые геномами асковируса, иридовируса, фикоднавируса и асфарвируса, связаны между собой и все содержат 7 консервативных доменов, разделенных шарнирами очень переменного размера.Мы исследовали эти консервативные домены дополнительно с помощью анализа гидрофобных кластеров (HCA, [35]). Этот анализ показал, что наибольшая консервация происходит на уровне гидрофобных остатков, как и ожидалось для структурных белков (дополнительный файл 3a и 3b). Вариабельность размеров шарниров между консервативными доменами и сохранение гидрофобных остатков может объяснить, почему поиск BLAST с использованием иридовирусных и асковирусных последовательностей MCP имеет ограниченную способность обнаруживать ортологи MCP в геномах фикоднавируса и асфарвируса.Мы разработали две синтаксические модели (см. Материалы и методы), которые вместе смогли специфически выровнять все последовательности MCP четырех семейств вирусов. Важно отметить, что WAPAM выровнял структурный белок P44 ихновируса CsIV с обеими моделями. Комплементарные структурные и HCA подтвердили присутствие семи консервативных доменов в этом структурном белке CsIV (рис. 3a и дополнительный файл 3c).

    Рисунок 3

    Сравнение последовательностей (дорожки 1–3) и вторичной структуры (дорожки 4–6) среди (а) MCP и (б) ортологов SfAV1a ORF061 от CsIV (дорожки 1 и 4, набраны черным), DpAV4 (дорожки 2 и 5, набраны синим) и SfAV1a (дорожки 3 и 6, набраны фиолетовым). Консервативные положения в аминокислотной последовательности CsIV и DpAV4 и SfAV1a выделены серым цветом. Вторичные структуры в трех ортологах ORF061 SfAV1a были рассчитаны с помощью Network Protein Sequence Analysis на http://npsa-pbil.ibcp.fr/, а статистическая релевантность вторичных структур оценивалась с помощью Psipred на http: //bioinf.cs. ucl.ac.uk/psipred/. C, E и H в дорожках 4-6 соответственно указывают для каждой аминокислоты, что она участвует в спиральной, b-листовой или спиральной структуре.При использовании параметров Psipred по умолчанию заглавные буквы указывают на то, что предсказанная вторичная структура является статически значимой в результатах Psipred. Значительные второстепенные структуры выделены желтым цветом. В (a) сравнения были ограничены тремя из семи консервативных доменов (дополнительный файл 3a, b и 3c), 2, 5 и 7. Действительно, классические методы in silico оказались неподходящими для прогнозирования статистически значимых вторичных доменов. структур консервативного структурного белка, богатого цепью b, такого как иридовирус и асковирус MCP.Напротив, полное и согласованное сравнение областей было получено с помощью профилей HCA (рис. S3b, c).

    В дополнение к вышеупомянутому анализу были разработаны десять синтаксических моделей с использованием белков, консервативных в трех секвенированных видах асковирусов (SfAV1a, TnAV2c и HvAV3a) и двенадцати иридовирусах [36]. Ни одна из этих моделей не обнаружила гомологов среди белков ихновирусов, доступных в базах данных, за исключением одного (см. Раздел «Материалы и методы»), разработанного из небольших белков, кодируемых ORF041 DpAV4, ORF061 SfAV1a, ORF74 HvAV3a и ORF118 TnAV2c в геномах асковирусов и иридовируса. Геномы ORF347L CIV и ORF096R мимивируса MIV соответственно.Важно отметить, что эти белки имеют ортологи у иридовирусов позвоночных, фикоднавирусов и асфарвирусов. В SfAV1a пептид, кодируемый ORF061, является одним из компонентов вириона. В асковирусах, иридовирусах, фикоднавирусах и асфарвирусах они были аннотированы как тиоредоксины, белки, которые играют роль в инициации вирусной инфекции [37–39]. Анализ базы данных с помощью нашей модели выявил четыре совпадения с последовательностями CsIV (код № M80623, S47226, AF236017, AF362508), каждый из которых является гомологом ORF ORF061 SfAV1a.Фактически, эти последовательности соответствуют нескольким вариантам одной области, содержащейся в сегменте B генома CsIV. На сегодняшний день они не аннотированы в окончательном геноме CsIV, вероятно, потому, что они перекрывают сайт рекомбинации. Анализ HCA подтвердил, что гидрофобные ядра были сохранены (рис. 3b и дополнительный файл 3d и 3e).

    Хромосомные положения генов, кодирующих эти два белка CsIV, то есть P44 и P12, также соответствовали гипотезе симбиогенеза.Фактически, ORF, кодирующая P44, не обнаруживается в провирусной ДНК. Примечательно, что ORF, кодирующие ортологи P44 или других структурных белков, таких как MCP, не обнаружены ни в одном из трех других секвенированных геномов ихновирусов — TrIV, GfIV, HfIV [8, 14]. Следовательно, это указывает на то, что ортологи МСР ихновирусов и других структурных белков вирионов также, вероятно, находятся в геномах этих ос, т.е. не в провирусной ДНК. В отличие от этого, мы обнаружили, что ген, кодирующий ортолог CsIV ORF061 SfAV1a, расположен внутри провирусной ДНК.Независимо от того, участвуют ли белки-ортологи одинаково в биологии TrIV, GfIV и HfIV, их гены не обнаруживаются в провирусной ДНК, поскольку в их вирусных геномах совпадений не обнаружено. Филогенетический анализ, проведенный ранее на ортологах P44 и ORF061 SfAV1a [15], показал, что у них есть предок, близкий к предкам асковирусов и иридовирусов.

    Как и в случае генов, кодирующих семейство NTP-аз Pox-D5 во всех асковирусах, иридовирусах и GfIV, гены, кодирующие вирионные белки, не могут быть результатом горизонтального переноса из генома ихновируса кампоплегина или банчина на все асковирусы, иридовирусы, фикоднавирусы и асковирусы. геномы.Поскольку гены асковирусов, кодирующие два исследованных здесь белка вириона, являются ближайшими родственниками белков вириона в CsIV, их можно рассматривать как ориентир, отражающий симбиогенное происхождение двух линий ихновирусов от асковирусов, тесно связанных с DpAV4. Фактически, трудности, возникающие при выяснении взаимосвязи их последовательностей, можно объяснить сочетанием заметного перехода от асковируса к ихновирусу и значительных ограничений отбора, которые возникли в результате эволюции последнего типа вируса от первого.

    Влияние интимной среды на латеральный перенос генов

    Анализ имеющихся геномов асковирусов, иридовирусов и ихновирусов является одним из первых молекулярных подтверждений гипотезы о том, что ихновирусы произошли от асковирусов путем симбиогенеза. Однако изучение генов, общих только для геномов асковирусов, иридовирусов и ихновирусов, вероятно, ограничивает источники генов, которые способствовали эволюции и сложности этих вирусов, особенно роль латерального переноса генов.К этому относится недавнее открытие, что важная часть геномов мимивирусов и фикоднавирусов имеет бактериальное происхождение [28]. Очевидно, это не привело к выводу о бактериальном происхождении этих вирусов. Цитоплазматическая среда, в которой реплицируются эти вирусы, богата бактериальной ДНК, потому что их амобы и одноклеточные водоросли-хозяева питаются бактериями, которые они переваривают в своей цитоплазме. Таким образом, было высказано предположение [28], что латеральные переносы бактериальной ДНК внутри этих вирусных геномов управляются тесным сочетанием рекомбинации и репликации вирусного генома.Действительно, репликация этих вирусов аналогична репликации бактериофага Т4. Этот способ репликации получил название репликации с рекомбинацией. Он позволяет интегрировать молекулы ДНК с гомологией последовательностей всего 12 п.н. [28, 40]. Аппарат репликации, используемый асковирусами, иридовирусами, мимивирусами, фикоднавирусами и другими нуклеоцитоплазматическими крупными ДНК-вирусами (NCLDV) [41, 42], является общим для всех из них, несмотря на различия в специфике репликации в каждом семействе вирусов. Следовательно, можно ожидать, что репликация, примированная рекомбинацией, происходила неоднократно в процессе эволюции как этих вирусов, так и генома их эукариотических хозяев.В эукариотической клеточной среде, в которой бактерии, хромосомы, вирусы NCLDV и не-NCLDV (например, бакуловирусы) тесно сожительствуют временно или постоянно, репликация с рекомбинационным праймером может обеспечить реципрокный пассивный латеральный перенос между вирусными геномами, хромосомами хозяина и бактериальной ДНК. . В этих условиях боковые передачи считаются пассивными, поскольку они являются результатом интимной среды, а не активного механизма, предназначенного для генетического обмена. У асковирусов и иридовирусов наличие таких латеральных переносов подтверждается поиском BLASTp, который обнаружил присутствие ORF, ближайшие родственники которых происходят из эукариотических геномов (например,g., для DpAV4, в дополнительных данных 1, ORF 029, 049, 077, 080, 083, 118), бактериальных геномах (например, для DpAV4, в дополнительных данных 1, ORF 056, 057, 059, 112, 115 и 119) или вирусы, принадлежащие к другим семействам NCLDV и не-NCLDV (например, для DpAV4, в дополнительных данных 1, ORF 007, 037, 062, 068).

    Передача асковирусов необычна тем, что они слабо заразны per os и, по-видимому, передаются среди чешуекрылых хозяев паразитами-осами-переносчиками при откладывании яиц [7, 43].Геном асковирусов может реплицироваться в присутствии полиднавирусной ДНК либо в репродуктивных тканях самок ос, либо в организме паразитированных хозяев, инфицированных как полиднавирусом, так и асковирусом. Следовательно, можно ожидать наличия интегрированных последовательностей асковирусного происхождения в геномах ос и полиднавирусов. В свою очередь, последовательности полиднавирусного происхождения могли быть интегрированы в геномы асковирусов, независимо от происхождения осы, ихневмонид или браконида. Одно семейство генов, родственное бактериальному семейству N-ацетил-L-глутамат-5-фосфотрансферазы (Прим.Число ближайших родственников бактерий (YP_001354925, CAM32558, ZP_00944224, ZP_02006449), идентифицированных только в геномах SfAV1a, HvAV3e и TnAV2c, подтверждает этот вывод. Он был обнаружен в геноме браковируса Cotesia congregata BracoVirus (CcBV [13]; рис. 4). Поскольку этот ген отсутствует в геноме Microplitis demolitor BV, родственного браковируса [8], трудно сделать вывод о направлении латерального переноса между общими предками трех асковирусов и осы C.Конгрегата . Однако они недвусмысленно указывают на то, что имел место по крайней мере один боковой перенос этого гена между общим предком асковирусов и паразитической осой.

    Рисунок 4

    Анализ аминокислотной последовательности белков, подобных N-ацетил-L-глутамат-5-фосфотрансферазе, кодируемых одним геном в SfAV1a (ORF1bis), двумя генами в HvAV3e (ORF 002 и 112) и TnAV2c (ORF) 024 и 148) и один ген в CcBV. Идентичные остатки между последовательностями выделены черным шрифтом, напечатаны белым, сходные — серым.

    Поскольку иридовирусы, такие как асковирусы и другие виды вирусов [44, 45], в некоторых случаях переносятся паразитическими осами, базы данных были добыты с использованием в качестве запросов всех доступных белков ихновирусов. Мы не обнаружили значимых взаимосвязей между геномами CsIV, HfIV и TrIV и геномами их предполагаемых ближайших родственников NCLDV и родственников, не относящихся к NCLDV. Это указывает на то, что пассивный латеральный перенос генов от вируса к эукариотам, который успешно распространяется и поддерживается в геномах ихновирусов, остается редким явлением.Один случай такого латерального переноса был описан в геноме CcBV. В этом геноме, помимо наличия кардинального эндогенного эукариотического ретротранпозона и полинтонов, транспонированных в хромосомную ДНК провирусной формы CcBV [46–48], два гена, кодирующие AcMNPV P94-родственные белки, которые имеют своих ближайших родственников среди грануловирусов ( XcGV). Это предполагает, что CcBV содержал по крайней мере два случая латерального переноса между не-NCLDV и браковирусом.

    Заключительные замечания

    Наши результаты представляют собой еще один источник доказательств того, что пассивный латеральный перенос генов происходил регулярно в процессе эволюции от бактерий к вирусам и эукариотам, а также между вирусами и эукариотами [49–52].Даже если гены pox-D5 NTPase в геноме GfIV и гены MCP и SfAV061-подобные в геноме CsIV указывают на то, что они имеют асковирусное происхождение, они предоставляют лишь ограниченные доказательства, подтверждающие асковирусное происхождение ихновирусов. Действительно, их консервация последовательностей и биологические характеристики предполагают, что в ходе эволюции между асковирусами и геномами ос, включая провирусные локусы ихновируса, происходили повторяющиеся латеральные переходы. Это поднимает важный вопрос о роли латеральных переносов во время совместной эволюции NCLDVs и не-NCLDVs, ихновирусов, ос и паразитированных хозяев.Действительно, генетические материалы различного происхождения обменивались и поддерживались во время совместной эволюции. Следовательно, это предполагает, что ихновирусы могут быть химерными объектами, частично возникающими в результате нескольких событий латерального переноса фрагментов ДНК вирусного происхождения.

    Симбиогенез был впервые предложен как эволюционный механизм, когда стало широко признано, что митохондрии и пластиды произошли от свободноживущих прокариот [7]. Геномы эндосимбиотических цианобактерий и протеобактерий, соответственно, лежащих в основе хлоропластов и мирохондрий, эволюционировали за счет уменьшения на несколько порядков до приблизительного размера плазмид.Одновременно ядерные геномы были реципиентами пластидных геномов. Это перемещение генов, кодирующих большинство белков эндосимбиотических бактерий, в ядро ​​хозяина является конечной стадией этого эволюционного процесса, так называемого эндосимбиогенеза [7, 53]. Недавние исследования растений показали постоянный приток ДНК из органелл в ядро ​​с момента возникновения органелл [54]. Это позволяет клетке-хозяину иметь генетический контроль над своими органеллами в отношениях, которые ближе к порабощению или одомашниванию, чем к симбиозу или мутуализму, при котором органеллы извлекают выгоду из своего вклада в благополучие эукариотических клеток.На сегодняшний день считается, что этот поток ДНК соответствует пассивному латеральному переносу, который является результатом взаимодействий между жизненным циклом органеллы и ядерной репликацией.

    Были охарактеризованы многочисленные случаи симбиогенеза между внутриклеточными бактериями и широким спектром эукариотических хозяев. Однако недавние исследования показали, что этот эволюционный процесс не ограничивался бактериями. Это также происходило между внутриклеточными эукариотами, такими как одноклеточные водоросли и грибковые эндофиты у растений [55, 56].Эндосимбиогенез также был предложен в качестве эволюционного механизма, который позволил некоторым вирусам беспозвоночных с большим геномом двухцепочечной ДНК, связанным с нудивирусами и асковирусами [22], привести, соответственно, к происхождению браковирусов и ихновирусов, которые в настоящее время признаны как образующие два рода в семействе Polydnaviridae. Хотя в настоящее время нет окончательных доказательств, опровергающих гипотезу о том, что сходство между ихновирусными и асковирусными вирионами является лишь эволюционной конвергенцией, геномные различия между асковирусом и ихновирусами хорошо согласуются с симбиогенетической гипотезой.В самом деле, они соответствуют эволюционному сценарию эндосимбиогенеза, во время которого из-за единственного события интеграции симбиотического вирусного генома вирусные гены теряются и / или перемещаются из провируса в другие хромосомные области (Рис. 5). Параллельно, гены-хозяева, представляющие интерес для паразитоидов осы, были интегрированы и диверсифицированы путем отбора и дупликации генов в провирусной ДНК. В этом сценарии, чем более древний симбиогенез, тем реже будут следы генов вирусного происхождения в геноме ихновируса.Это представляет собой ограничение, которое резко ограничивает возможность исследования эволюционных связей между асковирусом и ихновирусом. Результаты нашего анализа показывают, что ситуация также осложняется тем фактом, что латеральные переносы генов, не связанные с происхождением ихновирусов, вызывают важный вводящий в заблуждение фоновый шум. Более того, сценарий на рис. 5 близок к ранее предложенной версии [57], но не согласуется ни с результатами, представленными здесь, ни с недавно накопленными знаниями о переносе ДНК из органелл в ядро.Поскольку внутриклеточная среда благоприятствует латеральному переносу между ядром вируса и осы, можно предположить, что гены вирусного происхождения, которые участвуют в биологии ихновируса, были пассивно интегрированы в один или несколько локусов, шаг за шагом во времени, по отдельности или посредством переноса кластеров генов. , или даже весь вирусный геном. Поскольку паразитоидные осы способны переносить разные вирусы [44, 45], этот второй сценарий открывает захватывающую возможность того, что гены вируса, участвующие в биологии ихновируса, могут соответствовать генной лоскутной ткани, возникающей в результате переноса вирусов, принадлежащих к разным семействам NCLDV и не-NCLVD. .Из-за фонового шума из-за латерального переноса генов, обнаруженного в этих системах, выяснение происхождения ихновирусов потребует очень много времени, что потребует новых точных экспериментальных подходов для получения более надежных доказательств. Секвенирование геномов ос для идентификации белков вирусного происхождения, которые являются компонентами вирионов и участвуют в их сборке, может внести большой вклад в наше понимание того, как ихновирусы и браковирусы произошли от ДНК-вирусов других насекомых.

    Рисунок 5

    Гипотетический механизм интеграции и эволюции геномов асковирусов у эндопаразитических ос. Схематическое изображение трехэтапного процесса симбиогенеза и перестроек ДНК, которые предположительно произошли в зародышевой линии предков ос в линиях Banchinae и Campopleginae , от интеграции асковирусного генома до провирусного ихновирусного генома. Последовательности, происходящие от асковируса, показаны синим цветом, последовательности осы-хозяина и его хромосом — розовым. Гены асковирусного происхождения обведены тонкой черной или белой линией, в зависимости от их конечного хромосомного положения.Два решения могут объяснить окончательную хромосомную организацию генома провирусного ихновируса, монолокус или мультилокус, поскольку этот вопрос не полностью понят ни для одной из линий осы. Могут быть также предложены более сложные альтернативы этому трехэтапному процессу, которые могут включать, например, полное создание de novo моно- или мультилокусного провирусного генома из рекрутирования путем рекомбинации или транспозиции асковирусных генов и генов хозяина, расположенных в другом месте в хромосомы осы.Эта модель хромосомной организации провирусной ДНК у полиднавирусов согласуется с недавно опубликованными данными [58].

    Молекулярная эволюция — обзор

    4.07.4.1.2 Обзоры генов

    По мере перехода молекулярной эволюции от генетической эры к эре геномики, характер и масштабы исследований также изменились. Вместо того чтобы сосредотачиваться на генах-кандидатах, к которым обязательно подходили с априорными предубеждениями, можно было бы сразу рассмотреть весь геном.Где-то посередине между исследованиями кандидатов одного гена и геномными исследованиями было раннее исследование, в котором сравнивались скорости эволюции 214 генов, связанных с мозгом, с 95 контрольными генами (Dorus et al., 2004). Это исследование, такое как исследование FOXP2 , сосредоточено на различиях в скорости между линиями, здесь сравнивается расхождение человека и макака с мышью-крысой, а не явных сравнений между скоростью изменения аминокислот и нейтральным изменением внутри линий. Было обнаружено, что в целом гены, связанные с мозгом, развивались у приматов быстрее, чем у грызунов, и что в этих генах мозга те, которые связаны с функциями развития, развивались быстрее, чем гены с более физиологическими функциями у животных. взрослый мозг.Однако даже в то время ограниченность этой работы была признана. Он не был исчерпывающим, и группы компараторов были ограничены.

    Примерно в то же время другое исследование секвенировало ортологи шимпанзе, чтобы идентифицировать 7645 ортологичных троек человек-шимпанзе-мышь (Clark et al., 2003). Опять же, этот набор данных был исследован путем сравнения различий в скорости изменения белка между линиями. Полученные данные, хотя и приблизительные, предвещают будущие исследования. Были определены биологические категории, которые показали значительное ускорение в человеческом происхождении, но эти категории были довольно общими, и было не сразу очевидно, имеют ли они значение.Там, где можно было предположить значение, результаты не были особенно новыми или вдохновляющими (например, «обоняние», «слух» или «чувственное восприятие»). Широкая категория «процессы развития» была значительно ускорена у людей, но на самом деле было обнаружено, что и «развитие скелета», и «пролиферация и дифференцировка клеток» у шимпанзе изменяются быстрее.

    Первоначально эти результаты интерпретировались осторожно, а отсутствие конкретных новых результатов объяснялось отсутствием силы как глубины генов, так и широты видов.Однако по мере проведения дополнительных исследований, которые включали полные геномы шимпанзе и макак-резус и изучали различные методологические подходы, аналогичные результаты были повторены (Консорциум по секвенированию и анализу шимпанзе, 2005; Arbiza et al., 2006; Rhesus Macaque Genome, Анализ, Гиббс и др., 2007). Иногда категория или класс генов оказывались интересными, но чаще всего это было подтверждением уже хорошо установленных категорий, в частности, генов иммунного ответа, сенсорного восприятия и сперматогенеза, а также кажущегося случайным набором широчайшего биологического разнообразия. категории.По-прежнему возможно, что исследования просто не могли отделить действительно значимые или интересные различия от более широких изменений, которые происходили, или что наше понимание функции генов было слишком ограниченным, и что мы просто не оценили результаты. Более того, это предполагало, что гипотеза Кинга и Вильсона более верна, чем предполагалось, и что различия между людьми и шимпанзе следует искать не в белках, а, скорее, в регуляторных областях.

    Хотя геномная революция позволила разрастаться исследованиям эволюции белков, она не сильно изменила лежащий в их основе подход. Однако для регулирующих регионов это позволило разработать новые подходы, которые ранее не применялись на практике. Практически сразу это применили к вопросам, связанным с человеческим мозгом. Уже была проведена работа по изучению разницы в паттернах экспрессии лейкоцитов мозга, печени и крови человека по сравнению с шимпанзе, орангутанами и макаками-резус (Enard, Khaitovich et al., 2002; Caceres et al., 2003). Это продемонстрировало, что паттерны экспрессии человеческого мозга расходятся по уникальному паттерну, который не наблюдался ни у других видов, ни в других тканях. С публикацией генома шимпанзе, эта работа по экспрессии была распространена на предполагаемые регуляторные области (Khaitovich et al., 2005), подтверждая, что, хотя гены мозга более консервативны по сравнению с другими тканями, наблюдаемое расхождение непропорционально для человеческого происхождения. .

    Другое исследование, более явно сфокусированное на первичной нуклеотидной последовательности предполагаемых регуляторных областей.Используя ортологичные области от макаки-резуса, шимпанзе и человека, предполагаемую регуляторную последовательность выше по течению сравнивали с ассоциированной интронной последовательностью для 6280 генов (Haygood et al., 2007). Среди генов, которые продемонстрировали доказательства положительного отбора в регуляторной области, наблюдалось значительное обогащение генов, участвующих в нейрогенезе и «другой нейрональной активности». Однако это захватывающее открытие несколько смягчается, поскольку обе эти категории демонстрируют обогащение не только по линии человеческого происхождения, но также и по линии шимпанзе.Хотя адаптивная эволюция мозга не обязательно или даже ожидаемо ограничивается только людьми, ожидалось, что в ходе исследования были включены человеческие гены, связанные с мозгом. Независимо от ожиданий анализа, это было одно из первых исследований такого рода, и оно обнаружило генетические доказательства эволюции мозга без априорных предубеждений.

    Совсем недавно исследование было сосредоточено на выявлении регуляторных областей, которые были консервативными у шимпанзе и макак-резус, но отсутствовали у людей (McLean et al., 2011). Сосредоточившись на одной специфической делеции, соседней с геном-супрессором опухоли GADD45g , который удалил сайт связывания специфического для переднего мозга фактора транскрипции, трансгенные исследования с использованием репортерных генов на мышах подтвердили, что потеря этой области привела к изменению экспрессии, в частности, в развивающемся вентральном телеэнцефалоне. и промежуточный мозг. Предполагается, что эта потеря является механизмом, с помощью которого может быть достигнута пролиферация определенных типов нейрональных клеток.

    Молекулярные доказательства подтверждают ключевой принцип теории эволюции Дарвина — ScienceDaily

    Международная группа исследователей, включая биохимиков из Университета Монаша, обнаружила доказательства на молекулярном уровне в поддержку одного из ключевых положений теории эволюции Дарвина.

    Профессор Университета Монаша Тревор Литгоу сказал, что прорыв, финансируемый Австралийским исследовательским советом и недавно опубликованный в журнале Proceedings Национальной академии наук , обеспечивает общее понимание эволюции «механизма» наших клеток. .

    «Наши клетки и клетки всех организмов состоят из молекулярных машин. Эти машины состоят из составных частей, каждая из которых выполняет частичную функцию или структурный элемент машины.Каким образом могли развиваться такие сложные многокомпонентные машины, было несколько загадочно и весьма спорно », — сказал профессор Литгоу.

    В недарвиновском объяснении, исходящем от сторонников разумного замысла, предлагалось, чтобы эти сложные машины были «неснижаемо сложными». Другими словами, они настолько сложны и завершены, что не могли развиться, а скорее должны были быть созданы разумным существом.

    «Наши исследования показывают, что эти машины, хотя и законченные и сложные, были результатом эволюции.Простые «стержневые» машины были созданы у первых эукариот, опираясь на уже существующие белки, которые ранее выполняли отдельные, упрощенные функции », — сказал профессор Литгоу.

    В качестве модельной системы исследования были сосредоточены на одной конкретной молекулярной машине, комплексе TIM, который транспортирует белки в митохондрии. Митохондрии — это часть человеческих клеток, которые служат «электростанциями», производящими энергию. На очень ранней стадии эволюции митохондрии произошли от бактерий, которые жили в первых эукариотических клетках.

    «Наши клетки буквально являются химерами клетки-хозяина и этих внутриклеточных бактерий. Тем не менее, у бактерий нет комплексов TIM — чтобы понять, откуда появился комплекс TIM, мы просто применили научные рассуждения и посмотрели на современные бактерии, похожие на организм, породивший митохондрии ». — сказал профессор Литгоу.

    Группа изучила бактерию Caulobacter crescentus и обнаружила бактериальные белки, связанные с компонентами митохондриального комплекса TIM.Затем они показали, что эти бактериальные белки не встречаются в белковых транспортных машинах.

    «Франсуа Жакоб описал эволюцию как мастерицу, объединяющую белки одной функции, чтобы получить более сложные машины, способные выполнять новые функции». — сказал профессор Литгоу.

    «Наша работа описывает прекрасный пример предложения Джейкоба и показывает, что теория эволюции Дарвина прекрасно объясняет, как возникли молекулярные машины».

    К профессору Литгоу присоединились исследователи из Монаша д-р Эбигейл Клементс, д-р Деян Бурзак, д-р Ксения Гацос, д-р.Эндрю Перри, г-н Срджян Чивциристов и г-жа Нермин Челик вместе с исследователями из Мельбурнского университета и Йельского университета в США.

    Author: alexxlab

    Добавить комментарий

    Ваш адрес email не будет опубликован.